Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034757 (Tmub2)
Chromosomal location
Chr 11: 102146245 - 102150551 (+)
Description
transmembrane and ubiquitin-like domain containing 2 Gene [Source:MGI (curated);Acc:Tmub2-002]
RefSeq_dna
NM_028076 
RefSeq_peptide
NP_082352.1 
MGI
MGI:1919303 
Uniprot/SWISSPROT
Q3V209 
Uniprot/SPTREMBL
A2AWT0 A2AWT1 
Human Ortholog
ENSG00000168591 (TMUB2)
Omim not available
UniTrap UNI22653
Vector Insertion
Chr 11: 102147033 - 102148621
Public Clones not available
Private Clones OST288897 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107144
Sequence
TCCTGGATGTTAACAGCTTCCGAGAAAAGCCGGAAGAGATCGGACCCTGGACAGAATCCTGAGTTGCCAGCCCCTCCCCTGACCCCTACGGAAAGAGAAC

TACAAAGACTGTCCTGGCGAAGTCAAAACATTTATCCTGGCTTTGTCAG - UNI22653 - CGTGGACCCAGTCAGCAGCCAGGCCATGGAGCTCTCT

GATGTCACCCTCATTGAGGGTGTGGGTAACGAGGTGATGGTGGTAGCAGGCGTGGTGGCGCTGACTCTAGCCCTGGTCCTAGCCTGGCTCTCCACCTATG

TAGCAGACAGTGGTAACAACCAGCTGCTGGGCACCATTGTGTCAGCAGGTGACACGTCTGTTCTCCACCTGGGCCATGTGGACCAGCTGGTAAACCAAGG

CACTCCAGAGCCAACCGAACACCCCCATCCATCAGGGGGCAATGATGACAAGGCTGAAGAGACCAGTGACAGTGGGGGAGACGCCACTGGAGAACCTGGA

GCTAGGGGAGAGATGGAGCCCAGCCTGGAGCATCTCCTGGACATCCAAGGCCTGCCTAAAAGGCAAGCAGGCCTGGGGAGCAGTCGCCCAGAAGCCCCGC

TGGGGTTAGATGATGGCTCCTGCCTCTCTCCCAGCCCCAGCCTCATCAATGTTCGCCTCAAGTTCCTCAATGACACCGAGGAGCTAGCTGTGGCCAGGCC

AGAGGACACTGTGGGTACCCTAAAAAG CAAATACTTCCCTGGACAAGAGAGCCAAATGAAGTTGATCTACCAGGGTCGGCTGCTGCAGGACCCAGCACG

CACACTGAGTTCCCTGAACATTACCAACAACTGCGTGATCCACTGCCACCGCTCACCCCCAGGGGCAGCAGTTTCTGGCCCCTCAGCCTCCTTGACCCCA

ACCACTGAGCAATCTAGCCTTGGTGTCAACGTGGGCAGCCTCATGGTGCCTGTGTTTGTGGTGCTCTTGGGTGTGGTCTGGTACTTCCGTATCAATTACC

GCCAGTTCTTCACTGGACCTGCCACTATCTCCTTGGTTGGAGTCACAGTCTTCTTCAGCATCCTGGTATTTGGGATGTATGGAAGATAAGGACATCAGGA

GACAAAGAAAGGCATGGTCTTCCTCCTTCGTGGCCTCCCTCCTTTCCTGGCCAGAGCTGGGCCCAAGGACCTGGGAGGGAGGGATAGGAAGGGTATGGTG

GGTACCCTGTCCATAGGACCCAGGAAGCAGGTGTGTGGCCTCCCTTCATGTCCAGAGGGTACAGATATCTCTGCAAGCACAACTCAGGTAGAAATGAGGA

TATCATCTTCCCTCTTTTGGAATCCCAAAGTTCACAGGCCAAGATCAGTGAGAAGCCTGGGCTCTGGGTCTTCCCTCCTGGCTGTGGCCCAGTCTCTTGC

ATGTCTGTTCCCTAACCCCCAGGGTTGCTGCCAGGACAGCTCAGCATGGCCTTAGCATACTTCTGTAGGAAGCCTCAAGTACCTTCCACTCCTTAGATGA

GTGTGGACCTTTTGAAACTAAATTCACAGGGATGAAGACTGCCAGCCAGCCTTCCCTACAGCACCCAGCTGCCACCACCTCCTCCTTGTGCCCCTTGTAG

CAGGAATAGGATATTTTGCTTTCTTTTAAAGCACTTTGCTTGCTCTTTTTTTGTTTGTTTGTAAATAGTCCTGTATAGAGCTCAGTCAGGAAGGGGAGTG

GGGCAGAAGGCCAAGCCCCCAGCATTGAGGCCAGGCCACAGCTGCTGTTATCCTAGGCCTCTAGACTGCAAGAGTACTGGCCCTAATCCAGTGCCCTGCC

CAGTTCCAAGGATGAGCTCTGGGTATAGACTGCCCTCCCCTAAGCCCTTAGATGGTCAGTATGAATGAATAAAAATCCATTTTGTGGC
Translation
SWMLTASEKSRKRSDPGQNPELPAPPLTPTERELQRLSWRSQNIYPGFVS - UNI22653 - SVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVALTL

ALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQA

GLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLKS SKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPG

AAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR
Transcript ENSMUST00000100387
Sequence
ATGATTTCACGTCTTCTTCAAAACAACCTTATGAG - UNI22653 - CGTGGACCCAGTCAGCAGCCAGGCCATGGAGCTCTCTGATGTCACCCTCAT

TGAGGGTGTGGGTAACGAGGTGATGGTGGTAGCAGGCGTGGTGGCGCTGACTCTAGCCCTGGTCCTAGCCTGGCTCTCCACCTATGTAGCAGACAGTGGT

AACAACCAGCTGCTGGGCACCATTGTGTCAGCAGGTGACACGTCTGTTCTCCACCTGGGCCATGTGGACCAGCTGGTAAACCAAGGCACTCCAGAGCCAA

CCGAACACCCCCATCCATCAGGGGGCAATGATGACAAGGCTGAAGAGACCAGTGACAGTGGGGGAGACGCCACTGGAGAACCTGGAGCTAGGGGAGAGAT

GGAGCCCAGCCTGGAGCATCTCCTGGACATCCAAGGCCTGCCTAAAAGGCAAGCAGGCCTGGGGAGCAGTCGCCCAGAAGCCCCGCTGGGGTTAGATGAT

GGCTCCTGCCTCTCTCCCAGCCCCAGCCTCATCAATGTTCGCCTCAAGTTCCTCAATGACACCGAGGAGCTAGCTGTGGCCAGGCCAGAGGACACTGTGG

GTACCCTAAAAAG CAAATACTTCCCTGGACAAGAGAGCCAAATGAAGTTGATCTACCAGGGTCGGCTGCTGCAGGACCCAGCACGCACACTGAGTTCCC

TGAACATTACCAACAACTGCGTGATCCACTGCCACCGCTCACCCCCAGGGGCAGCAGTTTCTGGCCCCTCAGCCTCCTTGACCCCAACCACTGAGCAATC

TAGCCTTGGTGTCAACGTGGGCAGCCTCATGGTGCCTGTGTTTGTGGTGCTCTTGGGTGTGGTCTGGTACTTCCGTATCAATTACCGCCAGTTCTTCACT

GGACCTGCCACTATCTCCTTGGTTGGAGTCACAGTCTTCTTCAGCATCCTGGTATTTGGGATGTATGGAAGATAAGGACATCAGGAGACAAAGAAAGGCA

TGGTCTTCCTCCTTCGTGGCCTCCCTCCTTTCCTGGCCAGAGCTGGGCCCAAGGACCTGGGAGGGAGGGATAGGAAGGGTATGGTGGGTACCCTGTCCAT

AGGACCCAGGAAGCAGGTGTGTGGCCTCCCTTCATGTCCAGAGGGTACAGATATCTCTGCAAGCACAACTCAGGTAGAAATGAGGATATCATCTTCCCTC

TTTTGGAATCCCAAAGTTCACAGGCCAAGATCAGTGAGAAGCCTGGGCTCTGGGTCTTCCCTCCTGGCTGTGGCCCAGTCTCTTGCATGTCTGTTCCCTA

ACCCCCAGGGTTGCTGCCAGGACAGCTCAGCATGGCCTTAGCATACTTCTGTAGGAAGCCTCAAGTACCTTCCACTCCTTAGATGAGTGTGGACCTTTTG

AAACTAAATTCACAGGGATGAAGACTGCCAGCCAGCCTTCCCTACAGCACCCAGCTGCCACCACCTCCTCCTTGTGCCCCTTGTAGCAGGAATAGGATAT

TTTGCTTTCTTTTAAAGCACTTTGCTTGCTCTTTTTTTGTTTGTTTGTAAATAGTCCTGTATAGAGCTCAGTCAGGAAGGGGAGTGGGGCAGAAGGCCAA

GCCCCCAGCATTGAGGCCAGGCCACAGCTGCTGTTATCCTAGGCCTCTAGACTGCAAGAGTACTGGCCCTAATCCAGTGCCCTGCCCAGTTCCAAGGATG

AGCTCTGGGTATAGACTGCCCTCCCCTAAGCCCTTAGATGGTCAGTATGAATGAATAAAAATCCATTTTGTGGC
Translation
MISRLLQNNLMS - UNI22653 - SVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVALTLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHVD

QLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFLNDTEE

LAVARPEDTVGTLKS SKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLGVV

WYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR
Transcript ENSMUST00000036376
Sequence
GACTTCCTGTCCTGGATGTTAACAGCTTCCGAGAAAAGCCGGAAGAGATCGGACCCTGGACAGAATCCTGAGTTGCCAGCCCCTCCCCTGACCCCTACGG

AAAGAGAACTACAAAGACTGTCCTGGCGAAGTCAAAACATTTATCCTGGCTTTGTCAG TGTTAATTATTTTTGCTTCGATGATTTCACGTCTTCTTCAA

AACAACCTTATGAG - UNI22653 - CGTGGACCCAGTCAGCAGCCAGGCCATGGAGCTCTCTGATGTCACCCTCATTGAGGGTGTGGGTAACGAGGT

GATGGTGGTAGCAGGCGTGGTGGCGCTGACTCTAGCCCTGGTCCTAGCCTGGCTCTCCACCTATGTAGCAGACAGTGGTAACAACCAGCTGCTGGGCACC

ATTGTGTCAGCAGGTGACACGTCTGTTCTCCACCTGGGCCATGTGGACCAGCTGGTAAACCAAGGCACTCCAGAGCCAACCGAACACCCCCATCCATCAG

GGGGCAATGATGACAAGGCTGAAGAGACCAGTGACAGTGGGGGAGACGCCACTGGAGAACCTGGAGCTAGGGGAGAGATGGAGCCCAGCCTGGAGCATCT

CCTGGACATCCAAGGCCTGCCTAAAAGGCAAGCAGGCCTGGGGAGCAGTCGCCCAGAAGCCCCGCTGGGGTTAGATGATGGCTCCTGCCTCTCTCCCAGC

CCCAGCCTCATCAATGTTCGCCTCAAGTTCCTCAATGACACCGAGGAGCTAGCTGTGGCCAGGCCAGAGGACACTGTGGGTACCCTAAAAAG CAAATAC

TTCCCTGGACAAGAGAGCCAAATGAAGTTGATCTACCAGGGTCGGCTGCTGCAGGACCCAGCACGCACACTGAGTTCCCTGAACATTACCAACAACTGCG

TGATCCACTGCCACCGCTCACCCCCAGGGGCAGCAGTTTCTGGCCCCTCAGCCTCCTTGACCCCAACCACTGAGCAATCTAGCCTTGGTGTCAACGTGGG

CAGCCTCATGGTGCCTGTGTTTGTGGTGCTCTTGGGTGTGGTCTGGTACTTCCGTATCAATTACCGCCAGTTCTTCACTGGACCTGCCACTATCTCCTTG

GTTGGAGTCACAGTCTTCTTCAGCATCCTGGTATTTGGGATGTATGGAAGATAAGGACATCAGGAGACAAAGAAAGGCATGGTCTTCCTCCTTCGTGGCC

TCCCTCCTTTCCTGGCCAGAGCTGGGCCCAAGGACCTGGGAGGGAGGGATAGGAAGGGTATGGTGGGTACCCTGTCCATAGGACCCAGGAAGCAGGTGTG

TGGCCTCCCTTCATGTCCAGAGGGTACAGATATCTCTGCAAGCACAACTCAGGTAGAAATGAGGATATCATCTTCCCTCTTTTGGAATCCCAAAGTTCAC

AGGCCAAGATCAGTGAGAAGCCTGGGCTCTGGGTCTTCCCTCCTGGCTGTGGCCCAGTCTCTTGCATGTCTGTTCCCTAACCCCCAGGGTTGCTGCCAGG

ACAGCTCAGCATGGCCTTAGCATACTTCTGTAGGAAGCCTCAAGTACCTTCCACTCCTTAGATGAGTGTGGACCTTTTGAAACTAAATTCACAGGGATGA

AGACTGCCAGCCAGCCTTCCCTACAGCACCCAGCTGCCACCACCTCCTCCTTGTGCCCCTTGTAGCAGGAATAGGATATTTTGCTTTCTTTTAAAGCACT

TTGCTTGCTCTTTTTTTGTTTGTTTGTAAATAGTCCTGTATAGAGCTCAGTCAGGAAGGGGAGTGGGGCAGAAGGCCAAGCCCCCAGCATTGAGGCCAGG

CCACAGCTGCTGTTATCCTAGGCCTCTAGACTGCAAGAGTACTGGCCCTAATCCAGTGCCCTGCCCAGTTCCAAGGATGAGCTCTGGGTATAGACTGCCC

TCCCCTAAGCCCTTAGATGGTCAGTATGAATGAATAAAAATCCATTTTGTGGCTA
Translation
 MISRLLQNNLMS - UNI22653 - SVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVALTLALVLAWLSTYVADSGNNQLLGTIVSAGDTSVLHLGHV

DQLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFLNDTE

ELAVARPEDTVGTLKS SKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLGV

VWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR

For any suggestions or comments, please send an email to unitrap@crg.es