Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034845 (Plvap)
Chromosomal location
Chr 8: 74021666 - 74035651 (-)
Description
plasmalemma vesicle associated protein Gene [Source:MGI Symbol;Acc:MGI:1890497]
RefSeq_dna
NM_032398 
RefSeq_peptide
NP_115774.1 
UniGene
Mm.260768 
MGI
MGI:1890497 
Uniprot/SWISSPROT
Q91VC4 
Human Ortholog
ENSG00000130300 (PLVAP)
Omim not available
UniTrap UNI24645
Vector Insertion
Chr 8: 74030818 - 74030918
Public Clones not available
Private Clones OST211455 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38667
Vector Insertion
Chr 8: 74030569 - 74030818
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13540
Vector Insertion
Chr 8: 74022305 - 74030569
Public Clones CMHD-GT_406E12-3 (cmhd) CMHD-GT_138C2-3 (cmhd) CMHD-GT_395C2-3 (cmhd) CMHD-GT_300F9-3 (cmhd)
CMHD-GT_424G8-3 (cmhd) CMHD-GT_450B1-3 (cmhd) CMHD-GT_366A7-3 (cmhd) CMHD-GT_150B11-3 (cmhd)
IST12807A10 (tigm) IST12802B1 (tigm) IST10568H7 (tigm) IST10694A4 (tigm)
IST13992C5 (tigm) IST12125D8 (tigm) IST14118E9 (tigm) IST14522E4 (tigm)
IST12263B7 (tigm) IST14930F12 (tigm) IST14277B3 (tigm)
Private Clones OST445253 (lexicon) OST393868 (lexicon) OST388730 (lexicon) OST358581 (lexicon)
OST340171 (lexicon) OST307678 (lexicon) OST299722 (lexicon) OST225943 (lexicon)
OST180894 (lexicon) OST129326 (lexicon) OST37836 (lexicon) OST30759 (lexicon)
OST18071 (lexicon) OST15769 (lexicon) OST13116 (lexicon) OST9452 (lexicon)
OST8198 (lexicon) OST6266 (lexicon) OST6094 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110041
Sequence
CAACGCCAGACAGTGCGCCCTGTGGACACTGCGCAAATGGGGCTCTCCATGGACCGCAGCCCATACGCCCGCACGGGGGACCAGCAGCGCGGCTGCTGGT

ACTACCTGCGCTATTTCTTCCTCTTCGTGTCGCTCATTCAGTTCCTCATCATCCTGGGCCTGGTCCTCTTCATGATCTATGGCAATGTGCACGCCACCAC

TGAGTCCAGCCTGCGCGCCACGGAGATCCGCGCCGACAGCCTGTACAGCCAGGTGGTTGGACTATCTGCCTCACAGGCTAACCTGAGCAAACAGCTGAAC

ATCAGCTTGCTTGTCAAGGAAACAGTCATGCAGCAACTGTTGACTACGCGACGTGAGATGGAGCGCATCAACGCCAGCTTCCGCCAGTGCCAAGGCGACC

TG ATCACCTACATAAACTATAATCGCTTCATCGCCGCTATCATCCTGAGCGAGAAGCAGTGCCAGGAACAGCTGAAGGAGGTCAACAAGACCTGCGAAG

 CTTTACTCTTCAAGCTGGGAGAAAAAGTTAAGACACTGGAGATGGAGGTGGCCAAGGAGAAGGCAGTGTGCTCCAAGGACAAGGAGAGCCTGCTGGCAG

GAAAGCGGCAGGCGGAAGAGCAGCTGGAGGCCTGTGGCAAAGCACGCGAAAGGCAACAGCAGGAGCAGCAGGTGACCGAGGAGAACCTGCGCAAGGTGCA

GTCCCTGTGCATCCCACTGGACCAGGAGAAGTTCCAGGCGGACGTGCTGAGTGCGTGGCGGGACTCGCTGATCTACCGTACCTTGGAAACCCTGCCCTAC

CACTACCAGCTGATGCCGGAGTACGCGTCCCTCCGTCGGACCTGCGAGAGCCTGCCCGGGATCATGACCACCAAGATAGAAGAGCTGGCCCGCGGGCTGC

GCGCCGGCATTGAGCGCGTGACCCGTGAGAATGCAGAACTGCGGCGCCAGAAGTTGGAGCTAGAGCGCGCGGCACAGGCGGCGCAGGAGGCGCGGGCGCG

CGCCGGGACCGAGGCGCAGGCGCGAGAAACCCAGCTACGGGCGGAGTGCGCGCGCCAGACGCAGCTGGCTCTGGAGGAGAAGGCGGCGCTGCGCGCGCAG

CGGGACAACCTAGAGCGCGAACTGGAGGCGCGTAAGCGGGAGCTGGAGCAACTGCGCACCGAGGTGGATGTGCGCATTAGCGCGCTGGACACCTGCGTCA

AGGCCAAG TCGCTGCCAGCCGTCCCGCCGAGAGTCTCAGGCCCACCCCCGAACCCTCCACCCATTG - UNI24645 - ATCCAGCTAGCCTGGAGGA

ATTCAAGAAAAGGATCCTGGAGTCTCAGCGGCTCCCTGTAGTCAACCCTGCTGCCCAACCCAG AGGG
Translation
MGLSMDRSPYARTGDQQRGCWYYLRYFFLFVSLIQFLIILGLVLFMIYGNVHATTESSLRATEIRADSLYSQVVGLSASQANLSKQLNISLLVKETVMQQ

LLTTRREMERINASFRQCQGDL ITYINYNRFIAAIILSEKQCQEQLKEVNKTCEA ALLFKLGEKVKTLEMEVAKEKAVCSKDKESLLAGKRQAEEQLE

ACGKARERQQQEQQVTEENLRKVQSLCIPLDQEKFQADVLSAWRDSLIYRTLETLPYHYQLMPEYASLRRTCESLPGIMTTKIEELARGLRAGIERVTRE

NAELRRQKLELERAAQAAQEARARAGTEAQARETQLRAECARQTQLALEEKAALRAQRDNLERELEARKRELEQLRTEVDVRISALDTCVKAK SLPAVP

PRVSGPPPNPPPID - UNI24645 - DPASLEEFKKRILESQRLPVVNPAAQPR RG
Transcript ENSMUST00000048452
Sequence
CAACGCCAGACAGTGCGCCCTGTGGACACTGCGCAAATGGGGCTCTCCATGGACCGCAGCCCATACGCCCGCACGGGGGACCAGCAGCGCGGCTGCTGGT

ACTACCTGCGCTATTTCTTCCTCTTCGTGTCGCTCATTCAGTTCCTCATCATCCTGGGCCTGGTCCTCTTCATGATCTATGGCAATGTGCACGCCACCAC

TGAGTCCAGCCTGCGCGCCACGGAGATCCGCGCCGACAGCCTGTACAGCCAGGTGGTTGGACTATCTGCCTCACAGGCTAACCTGAGCAAACAGCTGAAC

ATCAGCTTGCTTGTCAAGGAAACAGTCATGCAGCAACTGTTGACTACGCGACGTGAGATGGAGCGCATCAACGCCAGCTTCCGCCAGTGCCAAGGCGACC

TG ATCACCTACATAAACTATAATCGCTTCATCGCCGCTATCATCCTGAGCGAGAAGCAGTGCCAGGAACAGCTGAAGGAGGTCAACAAGACCTGCGAAG

 CTTTACTCTTCAAGCTGGGAGAAAAAGTTAAGACACTGGAGATGGAGGTGGCCAAGGAGAAGGCAGTGTGCTCCAAGGACAAGGAGAGCCTGCTGGCAG

GAAAGCGGCAGGCGGAAGAGCAGCTGGAGGCCTGTGGCAAAGCACGCGAAAGGCAACAGCAGGAGCAGCAGGTGACCGAGGAGAACCTGCGCAAGGTGCA

GTCCCTGTGCATCCCACTGGACCAGGAGAAGTTCCAGGCGGACGTGCTGAGTGCGTGGCGGGACTCGCTGATCTACCGTACCTTGGAAACCCTGCCCTAC

CACTACCAGCTGATGCCGGAGTACGCGTCCCTCCGTCGGACCTGCGAGAGCCTGCCCGGGATCATGACCACCAAGATAGAAGAGCTGGCCCGCGGGCTGC

GCGCCGGCATTGAGCGCGTGACCCGTGAGAATGCAGAACTGCGGCGCCAGAAGTTGGAGCTAGAGCGCGCGGCACAGGCGGCGCAGGAGGCGCGGGCGCG

CGCCGGGACCGAGGCGCAGGCGCGAGAAACCCAGCTACGGGCGGAGTGCGCGCGCCAGACGCAGCTGGCTCTGGAGGAGAAGGCGGCGCTGCGCGCGCAG

CGGGACAACCTAGAGCGCGAACTGGAGGCGCGTAAGCGGGAGCTGGAGCAACTGCGCACCGAGGTGGATGTGCGCATTAGCGCGCTGGACACCTGCGTCA

AGGCCAAG TCGCTGCCAGCCGTCCCGCCGAGAGTCTCAGGCCCACCCCCGAACCCTCCACCCATTG - UNI24645 - ATCCAGCTAGCCTGGAGGA

ATTCAAGAAAAGGATCCTGGAGTCTCAGCGGCTCCCTGTAGTCAACCCTGCTGCCCAACCCAG - UNI13540 - CGGTTGAGGACCCAGCTGCCGCA

GGACGCTGGGTGCCAGAATCGCCCACCTGTGGATGGGGGCAGCCAGGTGCCCACAGTGCTGGACACCCGCCGTGCCTGCCGGCAGCCTCCACCCCCACGC

CTTCTCTGGCACCCCTTCACTGTCCCCTGCATCCCCGCCATTCCCCAGACACTGGATTTAAGGCACACACAGCTGTGAGATGACTTCACATCGACCCCTT

GTGCAGTGACCCGGATGGTGCCCCACCCACACATGAAGCACCCACAGCTCAGCTGCCACCCTAGGCAACTCCTCCGGTTTCCTATCACTCTGCTCCTGAC

CCGGGAGGTGAGAACAGGAAGCCCAGCCTTCAGCTCCCTTGGGAGTTTCCAGCCTCCCTCTTAAAGGCCACTAGGGTTTCCAGATCCTATTTGAGAGTCT

CCAGGCCTCCCCTGAAGGGTTCTAGCCACCACGCCCACAGGATTCCCATTAGGTTTTAAAGTCTTTTCCAGAGTCCGCTGGTTCCCCTCCTCCTCACAAG

GAAGGGCCTCAATTGTAGATGAGCGTTCCGGGTGGATCTTAGAGCCCTAGAGGGAGGCTTTTGCTTGTAGCCCCCTAAAGATATTACTGGCACATAATAA

ATATGAAAGTCCTTTG
Translation
MGLSMDRSPYARTGDQQRGCWYYLRYFFLFVSLIQFLIILGLVLFMIYGNVHATTESSLRATEIRADSLYSQVVGLSASQANLSKQLNISLLVKETVMQQ

LLTTRREMERINASFRQCQGDL ITYINYNRFIAAIILSEKQCQEQLKEVNKTCEA ALLFKLGEKVKTLEMEVAKEKAVCSKDKESLLAGKRQAEEQLE

ACGKARERQQQEQQVTEENLRKVQSLCIPLDQEKFQADVLSAWRDSLIYRTLETLPYHYQLMPEYASLRRTCESLPGIMTTKIEELARGLRAGIERVTRE

NAELRRQKLELERAAQAAQEARARAGTEAQARETQLRAECARQTQLALEEKAALRAQRDNLERELEARKRELEQLRTEVDVRISALDTCVKAK SLPAVP

PRVSGPPPNPPPID - UNI24645 - DPASLEEFKKRILESQRLPVVNPAAQPS - UNI13540 - SG

For any suggestions or comments, please send an email to unitrap@crg.es