Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034858 (BC031353)
Chromosomal location
Chr 9: 74823918 - 74879890 (+)
Description
Uncharacterized protein KIAA1370  [Source:UniProtKB/Swiss-Prot;Acc:Q69ZK7]
RefSeq_peptide
NP_705812.2 NP_001106754.1 
UniGene
Mm.469696 Mm.208955 
MGI
MGI:2387648 
Uniprot/SWISSPROT
Q69ZK7 
Uniprot/SPTREMBL
Q3TXZ2 Q8K266 Q6PAM7 
Human Ortholog
ENSG00000047346 (KIAA1370)
Omim not available
UniTrap UNI32970
Vector Insertion
Chr 9: 74824084 - 74850538
Public Clones IST14883G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038437
Sequence
GTATTCAA TAAAAATAGAGGCCTACGTTTGAGAA ATGCCTTGGATGAGTATTTTGAATATGACGCAGAGGAGTTCTTGGTCTCTTTGGCCTTGCTGAT

AACTGAAGGACGAACCCCGGAGTGCTCTGTGAAAGGCCGTGCAGAGAGTTTCCACTGCCCTCCAGCGCAGTCTCGCTTCCCAGGAACGGCCAGACATGAA

TGCAGCGACAAGCTGGCCCAG TGTCGCCAAGCCAGACGAACCAGATCTGAGGTCACACTGTTGTGGAAAAATAATCTCCCAATCATGGTGGAGGTGATG

CTCCTGCCGGATTGCTGCTACAGTGACGAGGGGCCTAGTACAGAGGGGGCAGATCTGAATGATCCCGCCATTAAGCAAGACGCACTGTTACTGGAGAGGT

GGATCTTGGAGCCAGTTCCCCGACA GAATGGTGACCGCTTCATCGAAGAGAAGGCACTTCTGCTGGCTGTCAGATCATTTGTGTTTTTTTCTCAGTTAA

GTGCTTGGCTGAGTGTTTCTCATGGTGCTATTCCACGAAACATTCTTTACAG AATCAGTGCTGCGGATGTCGACCTGCAGTGGAGTTTTTCACAGACTC

CAACTGAGCATGTGTTTCCCGTCCCCAATGTCTCTCACAATGTGGCCTTGAAAGTCAGCGTTCAGTCCTTACCCAGACAAGCTCATTATCCGGTTTTGAC

CTGTAGTATTCATACTAACATTGGTCTGTATGAGAAGAGAATTCAAGAACAGGAGCTTAGAGCCTGTCAGCACCATGGCCCTGGTGAGGTGGAGTACCGT

TGTCCCAGCAGCTCACAGAGCCTATGCAGCAAGCACACATGGACCATGGCACCCGTGAGTGCCCTGCACGTCAGAAGTGGCATGCCTCCCGAGTACACTG

CAGCCATTAGAAATGTCAGGCTCTGCCCAGGCACAGGCAGCAAGTCTGACCAGGGGGCACCTCAAGCCAGTGTCCTGGGCTTCAGTGGCACTGGGGGAGA

AGTGAGGTCACAGGAGGCGTCAGTGAGAACGTTCAAATCACTGCCTGTGGTCGATTCCAGTGTCTCCAGCTGTCAGAGCTCTCGGCAGCCAGTAGGGGAA

CCTAACCCTTTAATGGACTCCTTGATTCAGGATCGACAAGAAGTCATTGCCAGGATTGCTCAGCACTTGATTCACTGTGACCCCAGCTCCTCTAGAATGT

CTGAACTCCCCTTTAACACCCAGGAGTCCACGTCACTTAGCCCAAAGCTTCACCCAGTTTCACAGGAAAGTGGGTGTGTGAGGAGATATAAAGAAGCATT

CTCTGTCTCCTTTGGGAGTCCAGAGTTTGGCTCCCCAGGAGACAGCAGGGAGGGGAAAGTCAGAGAGAAGTCAGAAACCAGGCCAGGAGAAACTTGCACT

TCTCACAGTCTGTACCCTCGCCAGCCTGCTGGGGAGGCGAACCCACTGATTGGCTCTTTACTCCAGGAGCGGCAGGACGTCATAGCCAGGATTGCACAGC

ACCTAGAACACATCGACCCCGCAGCTCACATTCCCCGGCCTGCATTCAGCAAGCACGACTCCAATTCCATTCCTTCTAAAGTGTTCAGGAGTTCATTTGA

TGACAAAACCTTGTTGAAGAAGGGCAGAGAGAATGTCTCTGTCTCTGTGTCTCATACAGAAGTGTCCTTATTGGGAGACAGAGGTGATGGGGAAAGCCTC

AAACCTAGTAAATGCTTGCGATCTTTCAAATACAGCCCTCAAGAAAAGCCTTTGAAACCTGAAGTAAGAACTCAGCATCAGAACCATCCTGATAGCATCA

CCCCCACAGCCAGGCAGGAGCTGCTGAACAAGGCTGCTGGCTTACTAACTTCCTCTAACACAGCTCTCTGCAAAGAAAGCAGCTTGGGTTTGGTTAGCAG

ATTGGAAAGTACATCTTGTAAATTACAACTTAAGGAGCAAGAAATGAGCCATGAAACTGAGAAACAGTGTTTGCATTGCAACAGTATTGACAAACAGATT

TGCACAAATACATGTACGGAGAAAATCAACGACGAGCATAGTCCAGGATCTCTCCGTCATCTCCAGTGTGATGATTCAAAAGGTATTGACTCAAAACTAA

AAGTGACTCTGCTGGAAATGCCTGACAGTTTGAACAAGAACAAAACTAATTGTTCAAGTAAAGACTCCAAAAGATCCAAGACGTGTGAGCAAAGCATTCG

GGTTGGCACAGAAAATGACCTCAGTGAAGAGAATGAGGGTCCCGGAAGCACTGTATCAGACCGACTCAAAACTGAGCAGGAGGCAAAAAGGGACTCAGGT

GCTGGAAAACCTCACAGCGTAAAGCACTGTTTGTCTGCAGGCGAGAGGCTGCACAGCGCAGACATGTTG AGGACTACACTGAAACATTCAAGTGTCTGG

AGGAAACATAATTTTCATTCCTTGGATGGGACATCAACCAGAGCCTTTCATCCTCAGACGGGGCTGCCTCTCCTCTCAAGTCCA GTTCCTCAAAGAAAA

ACACAGTCAGGCTGCTTTGATCTAGACGCGTCGCTGCTGCATCTGAGAAGCCTATCCTCCAAAAG CTCTCGGCCATGCCTGAATATTGACGAGGACCCA

GATGTTCATGAAAAACCTTTTTTGAGTTCAAGTGCTCCACCAATCACAAGTCTTAGTCTCCTAGGAAATTTTGAG GAATCGGTTCTGAACTACCGTTTA

GACCCCCTCGGCATAGTCGATGGCTTTACGGCCGAGGTGGGAGCCAGTGGGACTTTCTGCCCAACGCACTTGACTCTGCCAGTGGAAGTGTCGTTCTACA

GTGTTTCCGATGATAATGCTCCCTCGCCTTACATG GGTGTGATTACTTTAGAGTCCCTTGGTAAAAGGGGTTATCGAGTACCTCCTTCAGGAACGATAC

AAGTG ACCTTATTCAATCCCAATAAGACTGTGGTGAAGATGTTTGTAGTCGTGTATGACCTACGAGGTATGCCAGCCAATCACCAGACATTCCTGAGAC

AGAGGACGTTCTCAGTTCCTGTTAAACAAGAGATGAAGAGAAGTATTAACAAAGAGAACGTCCAGCACACGGCACAGTTACTACGCTACCTCATACACCT

GAG GTTCCAGAGTTCTAAATCTGGAAAGATCTACCTCCATAGAGATGTCCGGCTCCTGTTCTCTAGAAAGTCCATGGAGGTCGATAGCGGTGCTGCGTA

TGAACTCAAATCCTACACTGAGTCGCCAACAAACCCTCAGTTTTCACCAAGATGTTGATGAGGGGGACAACTTAAAAGTATTTGCTCAGTACCCAAGCCT

GAACATGAGCATTCACAGAATGGAATACATCGAACGAGAGCCAGCGGAGCAGAGTGGCCCTCCTCTGTTGTCCTGGACCAGATTTTATTAAAGGACCCCT

GAAGTGAGACCCGTGATTCCTAAGTGGACTGGAAGCACCCGTGTCGTCGCCCTTTTTGTACTGTTGAAACCACTTCATTGGACAGTTGCAATAGCAAAAT

CCCCAGTTAGATTAGTGTTTACACATTTTATTTCTGTTATTTAATATTTAATGTTTTCCTTTATAGTCAAGTGATGTTTGTCTCTAGTGTTCTAATGTAG

CACAATCCTATGTAAAATCATACTATGTATTTTTGACATTATTGTTGAAATTGAAATATATGCATAAGTCTTT
Translation
VFN NKNRGLRLRN NALDEYFEYDAEEFLVSLALLITEGRTPECSVKGRAESFHCPPAQSRFPGTARHECSDKLAQ CRQARRTRSEVTLLWKNNLPIM

VEVMLLPDCCYSDEGPSTEGADLNDPAIKQDALLLERWILEPVPRQ QNGDRFIEEKALLLAVRSFVFFSQLSAWLSVSHGAIPRNILYR RISAADVDL

QWSFSQTPTEHVFPVPNVSHNVALKVSVQSLPRQAHYPVLTCSIHTNIGLYEKRIQEQELRACQHHGPGEVEYRCPSSSQSLCSKHTWTMAPVSALHVRS

GMPPEYTAAIRNVRLCPGTGSKSDQGAPQASVLGFSGTGGEVRSQEASVRTFKSLPVVDSSVSSCQSSRQPVGEPNPLMDSLIQDRQEVIARIAQHLIHC

DPSSSRMSELPFNTQESTSLSPKLHPVSQESGCVRRYKEAFSVSFGSPEFGSPGDSREGKVREKSETRPGETCTSHSLYPRQPAGEANPLIGSLLQERQD

VIARIAQHLEHIDPAAHIPRPAFSKHDSNSIPSKVFRSSFDDKTLLKKGRENVSVSVSHTEVSLLGDRGDGESLKPSKCLRSFKYSPQEKPLKPEVRTQH

QNHPDSITPTARQELLNKAAGLLTSSNTALCKESSLGLVSRLESTSCKLQLKEQEMSHETEKQCLHCNSIDKQICTNTCTEKINDEHSPGSLRHLQCDDS

KGIDSKLKVTLLEMPDSLNKNKTNCSSKDSKRSKTCEQSIRVGTENDLSEENEGPGSTVSDRLKTEQEAKRDSGAGKPHSVKHCLSAGERLHSADML RT

TLKHSSVWRKHNFHSLDGTSTRAFHPQTGLPLLSSP VPQRKTQSGCFDLDASLLHLRSLSSKS SSRPCLNIDEDPDVHEKPFLSSSAPPITSLSLLGN

FE ESVLNYRLDPLGIVDGFTAEVGASGTFCPTHLTLPVEVSFYSVSDDNAPSPYM GVITLESLGKRGYRVPPSGTIQV TLFNPNKTVVKMFVVVYDL

RGMPANHQTFLRQRTFSVPVKQEMKRSINKENVQHTAQLLRYLIHLR RFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKSYTESPTNPQFSPRC
Transcript ENSMUST00000081746
Sequence
CTGCCTTTGTGAGAAGCCTGCACGGGGAAGCGCAGCACCCAGCGCTTGCTCCACTCGCTCGCTCTCTCCTCTCCCGTGCTTTCCCTCCGCGGCTGACAGG

GTAGCAGCTGACAGCCGGAGGCTTCCAGTATGGTTTTCAGTGGGAACAAAGGGCTCCGCAGACAAG - UNI32970 - ATGCCTTGGATGAGTATTTT

GAATATGACGCAGAGGAGTTCTTGGTCTCTTTGGCCTTGCTGATAACTGAAGGACGAACCCCGGAGTGCTCTGTGAAAGGCCGTGCAGAGAGTTTCCACT

GCCCTCCAGCGCAGTCTCGCTTCCCAGGAACGGCCAGACATGAATGCAGCGACAAGCTGGCCCAG TGTCGCCAAGCCAGACGAACCAGATCTGAGGTCA

CACTGTTGTGGAAAAATAATCTCCCAATCATGGTGGAGGTGATGCTCCTGCCGGATTGCTGCTACAGTGACGAGGGGCCTAGTACAGAGGGGGCAGATCT

GAATGATCCCGCCATTAAGCAAGACGCACTGTTACTGGAGAGGTGGATCTTGGAGCCAGTTCCCCGACA GAATGGTGACCGCTTCATCGAAGAGAAGGC

ACTTCTGCTGGCTGTCAGATCATTTGTGTTTTTTTCTCAGTTAAGTGCTTGGCTGAGTGTTTCTCATGGTGCTATTCCACGAAACATTCTTTACAG AAT

CAGTGCTGCGGATGTCGACCTGCAGTGGAGTTTTTCACAGACTCCAACTGAGCATGTGTTTCCCGTCCCCAATGTCTCTCACAATGTGGCCTTGAAAGTC

AGCGTTCAGTCCTTACCCAGACAAGCTCATTATCCGGTTTTGACCTGTAGTATTCATACTAACATTGGTCTGTATGAGAAGAGAATTCAAGAACAGGAGC

TTAGAGCCTGTCAGCACCATGGCCCTGGTGAGGTGGAGTACCGTTGTCCCAGCAGCTCACAGAGCCTATGCAGCAAGCACACATGGACCATGGCACCCGT

GAGTGCCCTGCACGTCAGAAGTGGCATGCCTCCCGAGTACACTGCAGCCATTAGAAATGTCAGGCTCTGCCCAGGCACAGGCAGCAAGTCTGACCAGGGG

GCACCTCAAGCCAGTGTCCTGGGCTTCAGTGGCACTGGGGGAGAAGTGAGGTCACAGGAGGCGTCAGTGAGAACGTTCAAATCACTGCCTGTGGTCGATT

CCAGTGTCTCCAGCTGTCAGAGCTCTCGGCAGCCAGTAGGGGAACCTAACCCTTTAATGGACTCCTTGATTCAGGATCGACAAGAAGTCATTGCCAGGAT

TGCTCAGCACTTGATTCACTGTGACCCCAGCTCCTCTAGAATGTCTGAACTCCCCTTTAACACCCAGGAGTCCACGTCACTTAGCCCAAAGCTTCACCCA

GTTTCACAGGAAAGTGGGTGTGTGAGGAGATATAAAGAAGCATTCTCTGTCTCCTTTGGGAGTCCAGAGTTTGGCTCCCCAGGAGACAGCAGGGAGGGGA

AAGTCAGAGAGAAGTCAGAAACCAGGCCAGGAGAAACTTGCACTTCTCACAGTCTGTACCCTCGCCAGCCTGCTGGGGAGGCGAACCCACTGATTGGCTC

TTTACTCCAGGAGCGGCAGGACGTCATAGCCAGGATTGCACAGCACCTAGAACACATCGACCCCGCAGCTCACATTCCCCGGCCTGCATTCAGCAAGCAC

GACTCCAATTCCATTCCTTCTAAAGTGTTCAGGAGTTCATTTGATGACAAAACCTTGTTGAAGAAGGGCAGAGAGAATGTCTCTGTCTCTGTGTCTCATA

CAGAAGTGTCCTTATTGGGAGACAGAGGTGATGGGGAAAGCCTCAAACCTAGTAAATGCTTGCGATCTTTCAAATACAGCCCTCAAGAAAAGCCTTTGAA

ACCTGAAGTAAGAACTCAGCATCAGAACCATCCTGATAGCATCACCCCCACAGCCAGGCAGGAGCTGCTGAACAAGGCTGCTGGCTTACTAACTTCCTCT

AACACAGCTCTCTGCAAAGAAAGCAGCTTGGGTTTGGTTAGCAGATTGGAAAGTACATCTTGTAAATTACAACTTAAGGAGCAAGAAATGAGCCATGAAA

CTGAGAAACAGTGTTTGCATTGCAACAGTATTGACAAACAGATTTGCACAAATACATGTACGGAGAAAATCAACGACGAGCATAGTCCAGGATCTCTCCG

TCATCTCCAGTGTGATGATTCAAAAGGTATTGACTCAAAACTAAAAGTGACTCTGCTGGAAATGCCTGACAGTTTGAACAAGAACAAAACTAATTGTTCA

AGTAAAGACTCCAAAAGATCCAAGACGTGTGAGCAAAGCATTCGGGTTGGCACAGAAAATGACCTCAGTGAAGAGAATGAGGGTCCCGGAAGCACTGTAT

CAGACCGACTCAAAACTGAGCAGGAGGCAAAAAGGGACTCAGGTGCTGGAAAACCTCACAGCGTAAAGCACTGTTTGTCTGCAGGCGAGAGGCTGCACAG

CGCAGACATGTTG AGGACTACACTGAAACATTCAAGTGTCTGGAGGAAACATAATTTTCATTCCTTGGATGGGACATCAACCAGAGCCTTTCATCCTCA

GACGGGGCTGCCTCTCCTCTCAAGTCCA GTTCCTCAAAGAAAAACACAGTCAGGCTGCTTTGATCTAGACGCGTCGCTGCTGCATCTGAGAAGCCTATC

CTCCAAAAG CTCTCGGCCATGCCTGAATATTGACGAGGACCCAGATGTTCATGAAAAACCTTTTTTGAGTTCAAGTGCTCCACCAATCACAAGTCTTAG

TCTCCTAGGAAATTTTGAG GAATCGGTTCTGAACTACCGTTTAGACCCCCTCGGCATAGTCGATGGCTTTACGGCCGAGGTGGGAGCCAGTGGGACTTT

CTGCCCAACGCACTTGACTCTGCCAGTGGAAGTGTCGTTCTACAGTGTTTCCGATGATAATGCTCCCTCGCCTTACATG GGTGTGATTACTTTAGAGTC

CCTTGGTAAAAGGGGTTATCGAGTACCTCCTTCAGGAACGATACAAGTG ACCTTATTCAATCCCAATAAGACTGTGGTGAAGATGTTTGTAGTCGTGTA

TGACCTACGAGGTATGCCAGCCAATCACCAGACATTCCTGAGACAGAGGACGTTCTCAGTTCCTGTTAAACAAGAGATGAAGAGAAGTATTAACAAAGAG

AACGTCCAGCACACGGCACAGTTACTACGCTACCTCATACACCTGAG GTTCCAGAGTTCTAAATCTGGAAAGATCTACCTCCATAGAGATGTCCGGCTC

CTGTTCTCTAGAAAGTCCATGGAGGTCGATAGCGGTGCTGCGTATGAACTCAAATCCTACACTGAGTCGCCAACAAACCCTCAGTTTTCACCAAGATGTT

GATGAGGGGGACAACTTAAAAGTATTTGCTCAGTACCCAAGCCTGAACATGAGCATTCACAGAATGGAATACATCGAACGAGAGCCAGCGGAGCAGAGTG

GCCCTCCTCTGTTGTCCTGGACCAGATTTTATTAAAGGACCCCTGAAGTGAGACCCGTGATTCCTAAGTGGACTGGAAGCACCCGTGTCGTCGCCCTTTT

TGTACTGTTGAAACCACTTCATTGGACAGTTGCAATAGCAAAATCCCCAGTTAGATTAGTGTTTACACATTTTATTTCTGTTATTTAATATTTAATGTTT

TCCTTTATAGTCAAGTGATGTTTGTCTCTAGTGTTCTAATGTAGCACAATCCTATGTAAAATCATACTATGTATTTTTGACATTATTGTTGAAATTGAAA

TATATGCATAAGTCTTT
Translation
MVFSGNKGLRRQD - UNI32970 - DALDEYFEYDAEEFLVSLALLITEGRTPECSVKGRAESFHCPPAQSRFPGTARHECSDKLAQ CRQARRTRSE

VTLLWKNNLPIMVEVMLLPDCCYSDEGPSTEGADLNDPAIKQDALLLERWILEPVPRQ QNGDRFIEEKALLLAVRSFVFFSQLSAWLSVSHGAIPRNIL

YR RISAADVDLQWSFSQTPTEHVFPVPNVSHNVALKVSVQSLPRQAHYPVLTCSIHTNIGLYEKRIQEQELRACQHHGPGEVEYRCPSSSQSLCSKHTW

TMAPVSALHVRSGMPPEYTAAIRNVRLCPGTGSKSDQGAPQASVLGFSGTGGEVRSQEASVRTFKSLPVVDSSVSSCQSSRQPVGEPNPLMDSLIQDRQE

VIARIAQHLIHCDPSSSRMSELPFNTQESTSLSPKLHPVSQESGCVRRYKEAFSVSFGSPEFGSPGDSREGKVREKSETRPGETCTSHSLYPRQPAGEAN

PLIGSLLQERQDVIARIAQHLEHIDPAAHIPRPAFSKHDSNSIPSKVFRSSFDDKTLLKKGRENVSVSVSHTEVSLLGDRGDGESLKPSKCLRSFKYSPQ

EKPLKPEVRTQHQNHPDSITPTARQELLNKAAGLLTSSNTALCKESSLGLVSRLESTSCKLQLKEQEMSHETEKQCLHCNSIDKQICTNTCTEKINDEHS

PGSLRHLQCDDSKGIDSKLKVTLLEMPDSLNKNKTNCSSKDSKRSKTCEQSIRVGTENDLSEENEGPGSTVSDRLKTEQEAKRDSGAGKPHSVKHCLSAG

ERLHSADML RTTLKHSSVWRKHNFHSLDGTSTRAFHPQTGLPLLSSP VPQRKTQSGCFDLDASLLHLRSLSSKS SSRPCLNIDEDPDVHEKPFLSSS

APPITSLSLLGNFE ESVLNYRLDPLGIVDGFTAEVGASGTFCPTHLTLPVEVSFYSVSDDNAPSPYM GVITLESLGKRGYRVPPSGTIQV TLFNPNK

TVVKMFVVVYDLRGMPANHQTFLRQRTFSVPVKQEMKRSINKENVQHTAQLLRYLIHLR RFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKSYTE

SPTNPQFSPRC

For any suggestions or comments, please send an email to unitrap@crg.es