Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034863 (Ano8)
Chromosomal location
Chr 8: 74000284 - 74009862 (-)
Description
anoctamin 8 Gene [Source:MGI Symbol;Acc:MGI:2687327]
UniGene
Mm.475713 
MGI
MGI:2687327 
Uniprot/SWISSPROT
Q6PB70 
Uniprot/SPTREMBL
Q05CB5 
Human Ortholog
ENSG00000074855 (ANO8)
Omim not available
UniTrap UNI33523
Vector Insertion
Chr 8: 74000283 - 74002731
Public Clones IST13927G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093450
Sequence
GTCTCCTCCTCCGGCGCGCTCGGTGGTGCCACTCCGGTCCTCATGAGCCCGTGGCCCCCCAGCGCCCGGGCGTCCCGCGGCCCCTAACCTGCCCTGTCCT

CGCCATGGCCGAGGCGGCTTCGGGCGCCGGGGACGTGACCCTGGAGGGGGAGCGGGGCAAGAGGCCCCCTCCCGAGGGCGAGCCTGCGGCGCCTGCGTCT

GGAGTACTGG ATAAACTATTTGGGAAGAGGCTCCTGCAGGCTGGCCGCTACCTGGTGTCCCACAAGGCATGGATGAAGACAGTGCCCACTGAGGACTGC

GACGTGCTCATGACCTTCCCAG ACACCACTGATGACCACACGCTGCTGTGGCTGCTGAATCACATCCGGGTGGGCATTCCCGAGCTGATCGTGCAAGTT

CGCCACCACCGCCACACGCGTGCCTATGCCTTCTTTGTCACCGCCACATACGAGAG CCTGCTCCGTGGGGCCGATGAGCTGGGTCTGCGCAAGGCCGTG

AAGGCCGAATTTGGAGGGGGCACCCGCAGCTTCTCCTGCGAAGAGGACTTCATCTACGAGAATGTGGAGAGCGAGCTACGCTTCTTCACATCGCAG GAG

CGGCAGAGCATCATTCGCTTCTGGTTGCAGAACCTTCGAGCCAAGCAGGGGGAGGCTCTGCACAACGTGCGCTTCTTGGAGGACCAGCCAATCA CAGTT

CCGGAGCTGGCTGCACGAGGCATCATACAGCAGGTGTTTCCAGTTCACGAGCAGCGTATTCTGAATCGTCTCATGAAGTCCTGGGTGCAGGCCGTGTGTG

AAAACCAGCCTTTAG ATGATATCTGTGACTATTTTGGGGTGAAGATTGCCATGTATTTTGCCTGGCTGGGCTTCTACACATCGGCAATGGTTTATCCTG

CAGTTTTTGGCTCTGTTCTGTATACATTCACTGAGGCTGATCAG ACAAGCCGGGATGTTTCCTGTGTGGTCTTCGCTCTCTTCAATGTGATCTGGTCAA

CACTGTTCTTGGAGGAGTGGAAACGGAGGGGGGCAGAGCTAGCCTACAAGTGGGGTACACTAGACTCACCTGGGGAGGCTGTGGAGGAGCCACGTCCCCA

GTTCAGG GGCATCCGGCGCATCAGCCCCATCACCCGGGCTGAGGAGTTCTACTACCCACCCTGGAAGCGATTGCTTTTCCAACTACTTGTCAGCCTGCC

TCTGTGCCTGGCCTGTCTTATCTGTGTCTTTATACTGATGCTTGGCTGCTTCCAGCTGCAG GAGCTAGTCTTGAGTGTGAAGGGTCTGCCCCGCCTGGT

TCGCTTCTTGCCCAAGGTTATGCTAGCCCTGCTGGTCAGCGTGAGTGCTGAGGGCTACAAGAAGTTAGCTGTGTGGCTAAATGACATGG AGAATTACCG

GCTAGAGAGCACCTACGAGAGGCACCTTATCATCAAAGTCGTCTTG TTCCAGTTTGTCAACTCGTACTTGAGTCTGTTCTACATCGGCTTCTACCTCAA

AGACATGGACCGCCTAAAAGAG ATGCTGGCCACCCTACTCATCACCCGGCAGCTGCTGCAGAACGTGCGCGAGGTGCTGCAGCCGCACCTGTACCGCAG

GCTGGGCAGCGGGGAGCTGGGCTTGCGAACCATCCTGGAGCTGGCCCGGGCCCTGCTAGGCCTGCTGAACCCCTTGCGCCCGGATCCCCGACGGCACTTG

GAGGCCCAGGCTGATGAGGGCGGAGCTGGGAGCCGCAGGTGCCTGGGCGGTGGCTGCGGGGCGCCAGAGGAGGAGAATGAGGAGGAGGAGGAGGCAGCTG

TGGAGCGGAGGCCAGCAGGGGAAGGAGGGGAGGTTCCAGAAGGGCCTCGGGGTGGCAAGGAGGAGGACGAGGAGGAGGACGACGACGAAGACGAGGACGA

GGAATACGAGGGCGAGGAAGGAAGCCTCCTAGACTGCGGGCTGCGCCTCAAGAAGGTCAGCTTTGCTGAGCGGGGCGCAGGGCGGCGCAGGCCAGGCCCC

AGCCCAGACGGCCTCTTGGAGGAGGGGAGCCCTACCATGGTGGAGAAGGGGCTGGAGCCTGGTGTGTTTACTCTGGCCGAAGAAGACGATGAGCCTGAGG

GGCCTCCAGGCAGTCCCGGGCCAGAGCCCCAGACTGTCTTGCTTCGTCGGGCGAGGGGCGAGGGCCGTGACCAAGGTCCTGATGGAGACCGAGATACGGA

GACTGGCTCTGGCGACGCGGCTGGAAGACAGAAAAGACATAACAGGTCCTCGTGGATCGACCCGCCAGAGGAGGAGCATTCACCGCAGCTCACGCAGGCA

GAGCTAGAGAGCTGCATGAAGAAGTATGAG GACACCTTCCAGGACTACCAGGAGATGTTCGTGCAGTTTGGCTATGTAGTGCTCTTCTCCTCTGCCTTC

CCACTGGCCGCCCTGTGCGCCCTCGTCAACAACCTGATTGAGATCCGAAGTGATGCCTTCAAGCTCTGCACTGGCCTGCAGAGGCCCTTTGGCCGGCGTG

TGGAGAGCATTGGCCAGTGGCAG AAGGTCATGGAGGCGATGGGTGTGCTGGCCATCGTGGTAAACTGCTACCTCATTGGCCAGTGTGGCCAGCTGCAGC

GCCTGTTCCCCTGGCTGAGCCCAGAGGCGGCCATTGTATCTGTGGTGGTGCTAGAG - UNI33523 - CACTTGGCTCTTCTAGTCAAGTACCTCATC

CATGTAGCCATCCCTGACATCCCCGGCTGGGTAGCTGAGGAGATGGCCAAACTGGAGTACCAGCGACGGGAAGCTTTCAAG - UNI33523 - CGGCA

CGAGCGGCAGGCGCAGCAGCGCTTTCAGCAGCAGCAGCGGCGGCGGCGCGAGGAGGAGGAGCGGCAGCGGCACGCGGAGCAGCAGGCGCGGCGGGAGCGC

GACACGGGAGGCCGCGAGGAGGCGCGCGCGGAGGCGCCGGGTCCTGACCCCGTGGCGGAGCGGGGCGCTGCCAAGGCCAAGGGCAGCGAGCGGCCCCGAC

GGCCCGGAGCGCTGCTGCCACCCGGACCTGTGCTGCGGCTGAAGCAGATCATCCCGTTGCAGACTCGGCCGCCCGCGCCCACCGGGTGCGCGCCCCCGCC

GCGCTCGCCCGCGGACACGCGCCTGCCCGCCTTCCTCAGCCTGCGCTTCCTCAAGGCTCCGGAGCGAGGCCCGTCCCCGCCGCGGCCCGGGAAGCTGTTC

GCATTCTCGGCGCGCGAGCCCTCAGCCAACGGGGCCCCCGGGGGCGGCGCGCGCGCTCACAGGAGCGCCGGGGACGAGCCCGCGGCCGCCGAGCCCGAAC

CGCGGCCGGAGGACGCAGGTCACAGGCCTTAA
Translation
MAEAASGAGDVTLEGERGKRPPPEGEPAAPASGVLD DKLFGKRLLQAGRYLVSHKAWMKTVPTEDCDVLMTFPD DTTDDHTLLWLLNHIRVGIPELIV

QVRHHRHTRAYAFFVTATYES SLLRGADELGLRKAVKAEFGGGTRSFSCEEDFIYENVESELRFFTSQ ERQSIIRFWLQNLRAKQGEALHNVRFLEDQ

PIT TVPELAARGIIQQVFPVHEQRILNRLMKSWVQAVCENQPLD DDICDYFGVKIAMYFAWLGFYTSAMVYPAVFGSVLYTFTEADQ TSRDVSCVVF

ALFNVIWSTLFLEEWKRRGAELAYKWGTLDSPGEAVEEPRPQFR GIRRISPITRAEEFYYPPWKRLLFQLLVSLPLCLACLICVFILMLGCFQLQ ELV

LSVKGLPRLVRFLPKVMLALLVSVSAEGYKKLAVWLNDME ENYRLESTYERHLIIKVVL FQFVNSYLSLFYIGFYLKDMDRLKE MLATLLITRQLLQ

NVREVLQPHLYRRLGSGELGLRTILELARALLGLLNPLRPDPRRHLEAQADEGGAGSRRCLGGGCGAPEEENEEEEEAAVERRPAGEGGEVPEGPRGGKE

EDEEEDDDEDEDEEYEGEEGSLLDCGLRLKKVSFAERGAGRRRPGPSPDGLLEEGSPTMVEKGLEPGVFTLAEEDDEPEGPPGSPGPEPQTVLLRRARGE

GRDQGPDGDRDTETGSGDAAGRQKRHNRSSWIDPPEEEHSPQLTQAELESCMKKYE DTFQDYQEMFVQFGYVVLFSSAFPLAALCALVNNLIEIRSDAF

KLCTGLQRPFGRRVESIGQWQ KVMEAMGVLAIVVNCYLIGQCGQLQRLFPWLSPEAAIVSVVVLE - UNI33523 - HLALLVKYLIHVAIPDIPGW

VAEEMAKLEYQRREAFK - UNI33523 - RHERQAQQRFQQQQRRRREEEERQRHAEQQARRERDTGGREEARAEAPGPDPVAERGAAKAKGSERPRR

PGALLPPGPVLRLKQIIPLQTRPPAPTGCAPPPRSPADTRLPAFLSLRFLKAPERGPSPPRPGKLFAFSAREPSANGAPGGGARAHRSAGDEPAAAEPEP

RPEDAGHRP

For any suggestions or comments, please send an email to unitrap@crg.es