Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034893 (Cog3)
Chromosomal location
Chr 14: 76102158 - 76154300 (-)
Description
component of oligomeric golgi complex 3 Gene [Source:MGI Symbol;Acc:MGI:2450151]
RefSeq_dna
NM_177381 
RefSeq_peptide
NP_796355.2 
MGI
MGI:2450151 
Uniprot/SWISSPROT
Q8CI04 
Uniprot/SPTREMBL
Q3USH9 
Human Ortholog
ENSG00000136152 (COG3)
Omim not available
UniTrap UNI2988
Vector Insertion
Chr 14: 76147007 - 76154071
Public Clones AA0089 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7072
Vector Insertion
Chr 14: 76142314 - 76143372
Public Clones RRZ035 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6448
Vector Insertion
Chr 14: 76124643 - 76127514
Public Clones CSA111 (baygenomics) A048E08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2889
Vector Insertion
Chr 14: 76121999 - 76124517
Public Clones AE0170 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24219
Vector Insertion
Chr 14: 76119620 - 76121908
Public Clones not available
Private Clones OST230674 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049168
Sequence
GGCTCTGCCTGTCGGGCTCCGGTTCTGCGCCGCGGAGGGGCCCAGGGCTGCGGAGATGGCGGAGGCGGCGCTGCTGCTGCCGCCCGAGGCGGCGGCCGAG

CGGGACGCCCGCGAGAAGCTGTCTCTCTGGGATGGGAGACCCGACTCGATGGCGCCGCTGACAGACAGGCAGACGGACTCGGTGCTGGAGCTCAAGGCGG

CCGTGGAGAACCTGCCGGTGCCCGCCGAG - UNI2988 - CTCCCAATTGAAGATGTATGCAGCTTAGCATCCCAGTCGCTGCCCATTGAGCTGACTG

CTGTAGTGCCTGACTCTACAGAAGACATCCTGTTAAAGGGCTTCACTTCCTTAGGAATGGAAGAAGAAAGGATTGAGACTGCGCAGCAG TTTTTCTCAT

GGTTTGCAAAACTGCAAACTCAGATGGATCAGGATGAAGGAACTAAATATAG - UNI7072 - ACAGATGAGGGATTACTTGTCTGGGTTTCAGGAAC

AGTGTGATGCTATACTGAATGACGTGAACAGTGCTCTGCAGCATCAGGAGTCGTTGCAGAAACAGTATCTTTTTGTGTCCAATAAGACAGGAACTCTTCA

TGAAGCCTGTGAACAGCTCCTAAAAGAACAG TCGGAGCTTGCTGATCTTGCTGAGCACATCCAACAGAAGCTGTCTTATTTTAATGAGTTGGAGACGAT

TAACACA AAATTGAATTCCCCTACGTTGTCTGTGAATAGTGAAGGATTTATCCCTATGTTGGCCAAGTTAGATGATTGTATAACATATATTTCATCGCA

T CCTAATTTTAAAGATTATCCTGTATACTTACTGAAGTTTAAACAATGTCTTTCTAAAGCTTTGCACCTCATGAAGACATATACTGTGAACACACTGCA

GACTCTCACAAATCAGTTACTAAAAAGG GACCCCTCATCAGTCCCTAATGCAGACAATGCCTTCACACTATTTTATGTGAAATTTCGAGCCGCTGCCCC

TAAAGTCAGA ACTCTAATTGAACAGATAGAGCAACGATCTGAAAAGATACCCGA ATACCAGCACCTTCTCAATGACATCCACCAGTGTTACCTTGATC

AGCGGGAGCTCCTTTTGGGCCCAAGTATTGCCTACACTGTCACAGAGTTAACCAGCCAGAACAACAGAGACCATTGTGCCTTG GTTCGCAGTGGCTGTG

CCTTTATGGTCCATGTCTGCCAAGATGAGCACCAACTTTACAATGAATTTTTCACAAAGCCAACATCAAAATTAGA TGAGCTATTGGAGAAATTGTGCG

TGTCGTTGTATGATGTGTTCCGGCCCTTGATCATCCATGTCATTCACTTAGAGACTTTATCGGAGCTCTGTGGGATTCTTAAAAACGAAGTGCTTGAAGA

CCACGTACAGCACAACG CTGAACAACTGGGGGCATTTGCAGCTGGAGTAAAGCAGATGTTGGAAGATGTACAAGAGAGGCTTGTGTATCGAACCCATAT

CTACATTCAGACGGACATCACAGGCTACAAACCAGCGCCTGGAGATCTGGCATATCCTGATAAGCTAGTCATGATGGAG CAAATCGCACAGAGTTTAAA

GGATGAGCAGAAGAAGGCGCCTTCAGAAGCTTCCTTTTCAGATGTACGGTTAGAAGAAGGAGAAGCCAGTGGTTTAAGAAAGTCTG - UNI6448 - G

TTCAACAGACTCCCTCAATCCTAGACCACAGACGACGATCTCTCCAGCAGATCTTCACGGGATGTGGTATCCCACAGTTCGAAGGACACTTGTCTGTCTC

TCCAAATTATATAGATGCATAGAT - UNI2889 - AGGGCGGTGTTCCAAGGATTATCACAGGAAGCCTTGTCTGCCTGCATACAGTCCTTGCTAGGA

GCATCAGAGTCTATCAGCAAAAACAAG - UNI24219 - ACTCAGATTGATGGACAACTTTTCTTAATTAAACACCTTTTGATTCTTCGAGAACAAAT

TGCTCCATTTCACACTGAATTCACCATTAAGGAAATTTCCCTGGACCTCAAGAAAACTAGAG ATGCAGCATTTAAAATCCTGAACCCTATGACTGTTCC

ACGATTTTTTAGGCTGAATAGCAACAATGCCTTGATAGAGTTCTTGTTGGAG GGGACTCCTGAGATCAGAGAACATTATCTTGACTCTAAGAAGGACGT

AGACCGGCACCTGAAGTCAGCCTGTGAGCAGTTCATTCAGCAGCAGACCAGGCTGTTTGTAGAGCAGCTGGAGGAGTTCATGACAAAG GTATCAGCATT

GAAAACCATGGCCAGCCAGGGAGGCCCCAAGTACACCCTCTCACAGCAGCCGTGGGCACAGCCAG CAAAGGTCAATGACCTCGTGGCCACTGCCTACAA

GACAATAAAGACGAAGCTGCCGCTGACACTGAGAAGCATGGCTTTGTATTTGTCCAATAAGGACACGGAGTTCATCTTGTTTAAGCCTGTCAGG AATAA

CATTCAGCAAGTCTTCCAGAAGTTCCACGCTCTGCTAAAGGAAGAGTTCAGTTCTGAAGACATCCAAATCATTGCTTGTCCTTCCATGGAACAG CTGAA

CCTCCTGCTGTCAGTTTCAAAGTAGTCCCAGTGGACCACGAGTGTCAGCAGTCTGTCCCACAGGAGAGGCCTGAGGAGTCCTGCAGCCTGCAGGATGCCC

AAGACCCCCATGTGGGACGGCTCCTGTAGAACATGGATGTGCAGCCTGCAGAAGGAAACCTGGGTGAGCCAGAGAAGATCAAAATGCCAAAGACTGACAG

CAGGGATAGCTGCCTCATTGAACTGGTCTCCAGCAGTGGAGAGAAGCGACAGGGGGCCACAATTCACAGTGAAATGTTCCTTCACACAGCTTGTGCAATA

AAGTAGGTTACAGTAGTGACTAGTGTGATGCACTCATAGGAACTCAGCTGACTGGAAAGCTGCCGGGTCTCAGCAAGGCATTCACCCCGGCCATTCCTCG

GACGCTGTGACTTGAAGAACTCTTCCTTCTGTGTCCCGATGCAGAGCTTCTCATGCTGGGTCGAGCGAGGTTGAGTTGGAATCGGATGGTTGCTGCCAAG

AAGGCATCTAGCTTTTCCTGGACTCAGGCTGTCATCTTTCTGTGGGCTGACACAAGGCAGGGGCAGTTGCAAGAAGCCAAGGCCTCCTATAAGGCTCCTT

GAACTGCATCCTCCTCACTAGAGAGGTGTATCTTGATGATGGGGATCGCCACAGTGCCGGCACCAGTGTGTGAGTGGGAGTGACCAGTGAAGAGGTTTTA

GCGTGGCACAGCCTGGAGAGGAGGCGGCCTGTGGGGAGTGGGCTCATGGATGGAGCTTAGTTGCAGTCATTCTTTATAAAGTGAATACTCTTTGGTTGCC

TATGTTGTCCTAGACACTAGCCGTCCGGCATCCCCAGTCCTGCCATAGCTGAACACCTAAGTGTGGCAAACGCTGCCCGTACCTTAAATATGACACCAGT

CAAAAGTCAAAGGACTATAAGCATCTGTGAATTTCCCTACAAATTCCTCTTTGAATTTGGGATTGGATTGGCTTTGACCCTGGTGTTACAATAAATGTAG

CCAGTTTCTTGGTTCAGTTACTCAGACCGTCGTCTGTAGGGTGGGACAGTGCTGAGGGCTCTGAAATAGGGCAGATGACCTCATGGTGCAGGTGAAGGGA

CAGGAACAGCCTCTTGCACAGTTGCACGTGGGTGACCCATCCCGATGCAACAGGCCAGTTTCTCAGCCCAGTTTAAATTGGTGGTGGCCGTTGCTTGGTA

GAGCATATTACTCTGTATTTTGGGAAACTCAGAGGTAAGAGGGTCCATATTTTTTCTTTGCTATGAAATGAACGAGTTAGGAAGATTGTACTTACTATTT

TAAATACATGTCTTATGTGATAAACCATAATCTCCAGTTCTGTGTATTATATGTACATTGGGTGTTCAGATAGCCTTTCCAAAGAAGCGAGGACGTGACC

GTTGTACAGTGCTGTGGCTCAGCAGTCTGATGGACAGAGCAGGACTTGTTCGAGGACTCTTGTAGTGCTTTGATTTGTTTGTTTCTGAAAACACTCACAT

ACCTTACCAACTGCTGGGAGGGTGGGACTGATCCAGTTCGTTTGCTGAATGAATATTTGTTTAAATCTGTACAGTTTCACGTGTTTACTTATACAGAGTG

TACATACTTTGAAATAATTAATTTAAAATGCTTTATATTATTTAGCTAGAAATTGCTGTTTTTAATAAATAAATTTTTTTAAAAAATAAAGATCTTTGCT

TCCTA
Translation
MAEAALLLPPEAAAERDAREKLSLWDGRPDSMAPLTDRQTDSVLELKAAVENLPVPAE - UNI2988 - LPIEDVCSLASQSLPIELTAVVPDSTEDI

LLKGFTSLGMEEERIETAQQ FFSWFAKLQTQMDQDEGTKYR - UNI7072 - RQMRDYLSGFQEQCDAILNDVNSALQHQESLQKQYLFVSNKTGTL

HEACEQLLKEQ SELADLAEHIQQKLSYFNELETINT KLNSPTLSVNSEGFIPMLAKLDDCITYISSH PNFKDYPVYLLKFKQCLSKALHLMKTYTVN

TLQTLTNQLLKR DPSSVPNADNAFTLFYVKFRAAAPKVR TLIEQIEQRSEKIPE EYQHLLNDIHQCYLDQRELLLGPSIAYTVTELTSQNNRDHCAL

 VRSGCAFMVHVCQDEHQLYNEFFTKPTSKLD DELLEKLCVSLYDVFRPLIIHVIHLETLSELCGILKNEVLEDHVQHNA AEQLGAFAAGVKQMLEDV

QERLVYRTHIYIQTDITGYKPAPGDLAYPDKLVMME QIAQSLKDEQKKAPSEASFSDVRLEEGEASGLRKSG - UNI6448 - GSTDSLNPRPQTTI

SPADLHGMWYPTVRRTLVCLSKLYRCID - UNI2889 - RAVFQGLSQEALSACIQSLLGASESISKNK - UNI24219 - TQIDGQLFLIKHLLI

LREQIAPFHTEFTIKEISLDLKKTRD DAAFKILNPMTVPRFFRLNSNNALIEFLLE GTPEIREHYLDSKKDVDRHLKSACEQFIQQQTRLFVEQLEEF

MTK VSALKTMASQGGPKYTLSQQPWAQPA AKVNDLVATAYKTIKTKLPLTLRSMALYLSNKDTEFILFKPVR NNIQQVFQKFHALLKEEFSSEDIQI

IACPSMEQ LNLLLSVSK

For any suggestions or comments, please send an email to unitrap@crg.es