Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034974 (Dapk3)
Chromosomal location
Chr 10: 80646663 - 80655729 (+)
Description
death-associated protein kinase 3 Gene [Source:MGI Symbol;Acc:MGI:1203520]
RefSeq_dna
NM_007828 
RefSeq_peptide
NP_031854.1 
UniGene
Mm.10294 
MGI
MGI:1203520 
Uniprot/SWISSPROT
O54784 
Uniprot/SPTREMBL
Q05A21 
Human Ortholog
ENSG00000167657 (DAPK3)
Omim not available
UniTrap UNI5232
Vector Insertion
Chr 10: 80646821 - 80652683
Public Clones YTA407 (baygenomics) 5SE305D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28448
Vector Insertion
Chr 10: 80653257 - 80653342
Public Clones not available
Private Clones OST30734 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1401
Vector Insertion
Chr 10: 80655088 - 80655170
Public Clones CH0873 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047665
Sequence
GCCTCTTGGGAGAAGTCGGATCCGTGATAAACATTTCCTGTTTCCTCTGTCCCTCCAGCTCCTGTGTCCCCAGAATCCTTCAGAAGGCCAGCCGCCATGT

CCACATTCAGGCAAGAGGATGTTGAGGACCATTATGAGATGGGAGAGGAGCTTGGCAG - UNI5232 - TGGCCAATTTGCCATCGTGCGCAAGTGCC

AGCAGAAGGGCACGGGCATGGAGTATGCAGCCAAGTTCATCAAGAAGCGGCGCCTGCCATCCAGCCGGCGCGGTGTGAGCCGGGAGGAGATCGAACGCGA

GGTGAGCATCCTGCGCGAGATCCGCCACCCCAACATCATAACACTGCATGACGTGTTCGAGAACAAGACAGATGTGGTGCTGATCCTGGAGCTGGTGTCC

GGTGGCGAGCTTTTCGACTTCCTGGCCGAGAAGGAGTCATTGACGGAGGATGAGGCCACGCAGTTCCTCAAACAAATCCTAGACGGTGTCCACTACCTGC

ACTCCAAGCGCATCGCACACTTTGACCTGAAG CCCGAGAACATCATGTTGCTGGACAAGCACGCAGCCAGCCCCCGCATTAAGCTCATCGACTTTGGCA

TCGCGCACAGGATCGAGGCTGGCAGCGAGTTCAAGAACATCTTTGGCACACCCGAGTTTGTCG - UNI28448 - CCCCCGAGATCGTGAACTATGAG

CCACTTGGCTTGGAGGCTGACATGTG GAGCATTGGCGTCATCACCTACATCCT CCTGAGCGGAGCGTCCCCATTCCTGGGCGAGACCAAGCAGGAGAC

GCTGACGAACATCTCAGCAGTGAACTATGACTTTGATGAGGAATACTTCAGCAGCACCAGCGAGCTGGCCAAGGACTTCATCCGCAGGCTGCTGGTCAAA

GACCCCAA GAGGAGGATGACCATCGCACAGAGCCTGGAGCATTCCTGGATCAAG - UNI1401 - GTGCGCAGGCGCGAGGACGGCGCCCGGAAGCC

AGAGCGACGGCGGCTGCGCGCCGCGCGCCTGCGCGAGTACAGCCTCAAGTCCCACTCGAGCATGCCGCGCAACACGAGCTACGCCAGCTTCGAGCGCTTC

TCACGCGTGCTGGAGGACGTGGCGGCGGCAGAGCAGGGGCTGCGCGAGCTGCAGCGAGGCAGGCGCCAGTGCCGGGAGCGCGTGTGTGCGCTGCGCGCGG

CCGCCGAGCAGCGGGAGGCGCGCTGCCGCGACGGGAGCGCAGGGCTAGGGCGCGACCTGCGACGCCTGCGCACGGAGCTGGGGCGCACCGAGGCTCTGCG

CACGCGCGCGCAGGAGGAGGCGCGGGCGGCGCTGTTGGGTGCCGGGGGCCTGAAGCGTCGCCTGTGTCGCCTGGAGAACCGTTACGACGCGCTAGCCGCT

CAGGTGGCCGCTGAGGTGCAATTCGTGCGCGACCTGGTGCGTGCGCTGGAGCAGGAACGGCTGCAGGCTGAGTGCGGCGTGCGCTAGGCTGCGGCACCCC

CAGACCCCGACCCACCCCCAGAATAAA
Translation
MSTFRQEDVEDHYEMGEELGS - UNI5232 - SGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNIITLHDVFENK

TDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLK PENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVA

 - UNI28448 - APEIVNYEPLGLEADMW WSIGVITYIL LLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPK KRRM

TIAQSLEHSWIK - UNI1401 - VRRREDGARKPERRRLRAARLREYSLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCAL

RAAAEQREARCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAAQVAAEVQFVRDLVRALEQERLQAECGVR

For any suggestions or comments, please send an email to unitrap@crg.es