Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034993 (Vat1)
Chromosomal location
Chr 11: 101320053 - 101327455 (-)
Description
vesicle amine transport protein 1 homolog (T californica) Gene [Source:MGI (curated);Acc:Vat1-001]
RefSeq_dna
NM_012037 
RefSeq_peptide
NP_036167.1 
UniGene
Mm.29210 Mm.401503 
MGI
MGI:1349450 
Uniprot/SWISSPROT
Q62465 
Uniprot/SPTREMBL
Q3TXD3 Q3U331 Q499X4 Q5RKP0 
Human Ortholog
ENSG00000108828 (VAT1)
Omim not available
UniTrap UNI21606
Vector Insertion
Chr 11: 101324431 - 101327021
Public Clones IST11386G2 (tigm)
Private Clones OST324184 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16833
Vector Insertion
Chr 11: 101323875 - 101324222
Public Clones not available
Private Clones OST453546 (lexicon) OST244966 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36994
Vector Insertion
Chr 11: 101321690 - 101323602
Public Clones CMHD-GT_537C7-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040430
Sequence
GTCTAGCCATGTCCGCGGAGAGGGAAGCAGCTGAGGCGGCCACTGTGGCAGCGGCGACCGAGGCCGGGGCGGAGACCGGGACCGGAGCCGGGGAGGGTGC

GCCTTCGCAGCCCCCGACAGTCGAGGTGGCAAGCGACCCGCAGCCACCCCCGGCCCCCGAAGCGTCAGCATCCGCTTCGGCACCGCCACTGCGCTGCCTG

GTACTCACCGGCTTCGGTGGCTACGATAAGGTGAAGCTGCAGAGCCGGCCGGCGGTGCCCCCGGCCCCGGGTCCGGGTCAATTGACGCTGCGCGTGCGAG

CCTGTGGGCTCAACTTCGCCGACCTCATGGGCCGCCAAGGGCTGTACGACCGACTACCGCCTCTGCCGGTCACCCCCGGCATGGAGGGCGCGGGCGTGGT

AGTGGCAGTGGGCGAAGGCGTCGGCGACCGTAAG - UNI21606 - GCAGGGGATCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAGGAAG

TAACTGTGCCATCAGCCCAGACTTTCCTGATGCCTGAGGCCATGACCTTTGAAGAAGCTGCTGCCTTGCTGGTCAATTATATCACCGCCTACATGGTTCT

CTTTGACTTCGGCAACCTGAGACCGGGCCATAGCGTCTTGGTACACATGGCTGCAG - UNI16833 - GTGGCGTGGGCATGGCAGCCCTGCAGTTGT

GCCGCACCGTGGAGAACGTGACAGTGTTTGGAACGGCCTCAGCCAGCAAGCACGAGGTGCTGAAGGAGAACGGGGTCACACACCCCATCGACTACCACAC

GACTGACTATGTGGACGAGATCAAAAAGATCTCCCCCAAAG - UNI36994 - GAGTAGACATCGTCATGGACCCTCTGGGTGGATCAGACACGGCCA

AGGGCTACCACCTCCTCAAACCCATGGGCAAAGTTGTCACTTACG - UNI36994 - GAATGGCTAACCTGCTGACGGGCCCCAAGCGGAACCTGATG

GCCATGGCCCGCACCTGGTGGAATCAGTTCAGTGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGAGCTGTGTGTGGCTTCCACCTGGGCTACCTGGATG

GAGAGGTGGAACTCGTCAATAGCGTGGTCACCCGCCTCGTGGCTCTGTACAATCAGGGCCACATCAAACCTCGAATTGACTCAGTCTGGCCCTTCGAGAA

G - UNI36994 - GTGGCAGATGCAATGAAACAGATGCAGGAGAAGAAGAACATAGGCAAAGTCCTCCTGGTTCCTGGGCCTGAGAAGGAGACCTAGG

GCCAGAGGGCTGAGGGCCCTGGAGAGCCGGGGAGGGAGAAGATGGGAAGTCCTGTCGTGTTGCCCACCAGCCTCTCACATTTCATCCTGTCACGATGCTC

TACCCTCCCTCCCTCCCCCAGAGAAGGTCTCTGCTGATGACTGCTTCCCTGCTCTGAGCTCGCTCTTGCCCTTCGCTCAGGGCTCTCCCTCCCCCCCACC

CCTTCCTGCCCTCAGGAGAGGTTGGGAAGTGACCACTTGGATGTCTGGGCCCTGCCAAGGGGACAGGGGGGGTCAGCAGGAGGCTGGCTGCTTCCTGCCC

TCCCCCCTCTCCCTGGGCCTACCATGCTGCTTTTGTGCCAAGGTTAGCCAATCCCTCCCTGCCCTATCCTGTGTGCTTCCACCTCAGCCTCATCCTCCCT

CCTGCCCCACCCCCACCCAAAGAATCTATGCGTCAGCTCAGGACGTGGGGCCGATCTGTGTGAGTCCAGCATGTACCTGTGTCCCCCGTAGTATCCCCGC

AGCCCAGGCCGACGAGGCCCACCCCTGGACTTGATCAGTATTCAACCTTGTCTCCTGTCCCCAATGTCGTAAGCACAATTAGACTTCTTCCGGCTTGAGT

TTGCTGCCTCCTACAGCAAGGACAGGAATCAGACCGACTCCCTAGCTTACGCTCTGGGAGGGGTACTGGGTACCCCACCCTTCACTGAGGCCTTTGGATT

TGTCTCAGTGCCTTAGCATCTGAAAACCTGTGCTTGTATATGTGTGTGTATGTGTAGGGGCAGCCCCTATCTCTGGCTCCTTTTCCACCCTTCTCCCCAG

TGCCTTCCTCGTCCTGGTGGAGCTGAGGCCTACTCCTCCCCAGTCCAACACTGCCAAAAATCTGTGTATGTGCCAGGGGTCGGGGGTCTGGGGGTAGGGG

ACAGCTCCAGCCTCTGGGGACCAATTGCTTTTACTGTGGTCTGTGGCCTGTCCTGTCTCTGTCAGTGGAGAAGAAAGGCAGTGAGCTGGATCAGCCAGAG

TTCTGGGAGACAACGCTGGGTCTTATTCTGGGACCAAAGTGAGAATTCAAGCACATTTCTTTCCTTTGCTATGTAGGGAGGCTGCTGCCTTCCCAGAGCC

TGGAGGCAGCTCTGCTGTTCAGCCCCAAACTTTGTTTACACTGCTAGGGAAGGAGGAGCTCCGGCAAGGGAATAACTAGGCTGGTTAAAAGAGTCAGGGC

TACTGGAGCCAAGGTGGGGACCTTTGAGGCTAGGTGGGGGTCACCTGCTGCTTCTGAGCTTGGATTAGAGAAAGCTCTTAACTCCAGCCACTGTCAGAGG

GAGTGTGGAGGGAGGGACCCGGCCTCTCTGTTGTCAAATTGAGGCCTCCATGTGGGAAGTGTGATTTCTGCTTTTGTGTCCCATCCCCACCCCACCCCAT

TACCACAGCTGCCTTTGTGTCTGTGTCAATAAAAAGCCAAACCCTGAGTCCTG
Translation
MSAEREAAEAATVAAATEAGAETGTGAGEGAPSQPPTVEVASDPQPPPAPEASASASAPPLRCLVLTGFGGYDKVKLQSRPAVPPAPGPGQLTLRVRACG

LNFADLMGRQGLYDRLPPLPVTPGMEGAGVVVAVGEGVGDRK - UNI21606 - AGDRVMVLNRSGMWQEEVTVPSAQTFLMPEAMTFEEAAALLVNY

ITAYMVLFDFGNLRPGHSVLVHMAAG - UNI16833 - GGVGMAALQLCRTVENVTVFGTASASKHEVLKENGVTHPIDYHTTDYVDEIKKISPKG -

 UNI36994 - GVDIVMDPLGGSDTAKGYHLLKPMGKVVTYG - UNI36994 - GMANLLTGPKRNLMAMARTWWNQFSVTALQLLQANRAVCGFHL

GYLDGEVELVNSVVTRLVALYNQGHIKPRIDSVWPFEK - UNI36994 - VADAMKQMQEKKNIGKVLLVPGPEKET

For any suggestions or comments, please send an email to unitrap@crg.es