Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035045 (Zc3h12b)
Chromosomal location
Chr X: 92907017 - 93123309 (+)
Description
zinc finger CCCH-type containing 12B Gene [Source:MGI Symbol;Acc:MGI:2442133]
Human Ortholog
not available
Omim not available
UniTrap UNI38024
Vector Insertion
Chr X: 92974309 - 93093603
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044241
Sequence
AACTGCGCCGGGGCTGTGTGTGTAGGCAGCAGCGCCAGAGGAAGAGGAGCACGAGGATGCAGCTGCGACCGCGGCCCCAAGAGGGAGCAGCCACTGTTCT

GTGGTCGCGGGGCCAAAGCAATTGGAATTAAGCCTGGGGGGTCCTGTTGCTGAGAGGACCGGGGCAGACGGTCCTGCCAGAAGCGCAGGCCTAGTATTCC

GGGAGAGTTCGGTCTGCTGGGCGAAGGCCTGCCGCCTTTGCTTCCTCCTGGCCCTCCAAGTCGATGGTGGTGAAGTTGGTGGCCGCCAGGGGCACAAGCG

CCAGGCTGGTTCTCTTGCACCCGGCGCTTATCTGGCCCTGCTTGAACAGCTGCGACGCCGCCTCCTCTCTTCCGCGGATCCCACCCTCAGCGGCGGGGGA

GGGGGAAAGTTTTCCCCTCCGCAGGGGCTGCATGGTGCGAGGCGACAACAAGACCTTAGGAGAGTAGGG GAAGAAGCCAACAGTTGAGTTTGCTCCTGA

TTATACTCTGCTGAGCTGGACAGAGAGATCATGGAGA ATGCAACGTGACCAAATGTCTCATAATCCTGCTGCTGTATATTCACTGCCATGATGGACTGT

ATCCATTCAAACT - UNI38024 - GGTCTCCCTCTGTTGCCTATGGGGAGGGATATCTCTCCCAAGGCTCAAGGGAACCTCCTGTCTTGGCCTCCTG

AATTAATGGGACTTGAG AGACTGCTAACATCTGAACATACAAAACCAAACAGACAAAGTCTTGCACCATTGCTCCCCCCGCATTCTACTCTAGAGGAAT

GCCACTGTACATGGATTCCAAACAGGTTAAAAAGAAAAATAGCTGATTAGATCTCAGAGTACCCAGTGAACGGGATGACGGCCACAGCTGCAGTGGAGAC

ACCAAAAATGGAGAAGAGTGCTTCCAAGGAAGAGAAGCAACAGCCAAAGCAGGAGGACAGCACAGACCGAGGCAATGCTGATCCTGAAGAATGGGCGAAC

TCTGAGAGTGACCCTGAGCAGATGAGCTGTAAGAGTGGCCACACCAGCTACCAAGCCACAGATATTCAACTGAAGAAGAAAGAGATGCCCTCTAAGCCAC

ATCGTCCGCTCTGTCGGTCACCCTGCCTGGACCGGCCAAGCTTCTCCCAGAGCAGCATTTTACAGGATGGGAAGCTAGACTTGGAGAAAGAATACCAAGC

CAAGATGGATTTTGCTCTAAAGTTGGGTTATGCAGAAGAGCAAATTCAATCAGTGCTTAATAAACTAGGCCCAGAATCACTTATTAATGATGTATTAGCA

GAGCTTGTCAGACTTGGAAACAAAGGTGATTCGGAAGCACAAGTCAACTTGAGTCTATTACTGCCCCGAGGAGCAAGCTCCAGAGAGATTGCAAGCCCTG

AATTGTCTCTTGAAGATGAAATAGACAATAGTGATAATTTAAGACCAATTGTTATTGATGGAAGTAATGTGGCAATGAG CCATGGGAATAAAGAAGAAT

TCTCCTGCAGGGGAATACAACTTGCTGTGGATTGGTTTCTAGACAAAGGCCATAAAGATATCACGGTATTTGTACCAGCATGGAGAAAGGAGCAATCCCG

CCCCGATGCACCAATTACAG ATTTATGCCGCCAGATGATCCTCTTGGACGCCATGGTCCGAGCCTTGAGAATTTCTTAAGAAAGAGACCTGTGGTTCCT

GAGCATAAGAAGCAGCCATGTCCTTATG GCAAAAAATGTACCTACGGCCACAAGTGCAAATACTATCATCCGGAGCGGGCCAACCAACCCCAGCGTTCG

GTGGCTGATGAGCTCCGCATCAGTGCCAAACTGTCCACAGTGAAAATAATGAGTGAAGACACCCTGGCCAAATGTGGCGCAGGGATGTCTACTGCCAAAG

GTGAGATAACCTCAGAGATAAAACGTGTGGCCTCCAAGCGCCAATCAGATCCCAGCATCCGGTCTGTGGCTGTAGAGCCTGAGGAGTGGCTGTCCATCGC

CCGTAAACCTGAGGCCAGTTCTGTCCCTTCACTTGTGACCGCTTTAAGTGTCCCTACAATCCCTCCTCCCAAAAGCCATGCAGTGGGTGCACTCAACACC

CGTTCAGCCAGCAGCCCAGTGCCAGGGTCCTCCCATTTTCCCCATCAAAAGGCCTCTTTGGAACACATGGTCAGCATGCAATATCCACCTATCCTGGTTA

CCAACAGCCATGGCACCCCTATTAACTATACTGAGCAATACCCAAAGTTTGAGACCATGGGGGACCATGACTACTATTCAGTGTTAAGTGACTTCTCCAA

ACTGAGCATCAACAACATGCATAATCATGAATATTATATGGCTGAGGCAAACCAGGGGGTATATGTTCGGAATCCCGGCCTATGTACTGATAGTCACATG

AGCCATACCAGGAATGACAACTATTCCTCTTACAACAACCTGTACTTGGCTGTAGCTGATGCCCATCCTGAAGGCACTTTGAAGCTGCACCGCTCAGCAT

CTCATAACCATCTTCAGCCTTTTTCCCATGGTTACCATGAAGCCTTAGCAAGAGTTCAAAGTTATGGTTCCGAAGATTCCAAGCAAGCACCCCACAAGCA

GTCAGTCCCTCACTTAGCTGTGCATACCCAGAATCCAGCAACTGGAGCACACTCTAGCTGTCCTGGAGACTACACCATGCCTCCCAGTATCCATCCTGTG

GGACCCTCCCAGCCAGGCCGGGCTCTGGTGATGACTCGAATGGACAGCATTTCTGACTCCCGCCTCTATGACAGCAACCCCATGAGGCAAAGACGGCCTC

CTCTGTGCAGAGAACAGCATGCTAGCTGGGACCCATTGCCTTGTACAGCCGACTCCTATGGATACCACTCCTATCCCTTAGGGAACAGCCTCATGCAACC

GTGTTATGAACCAGTCATGGTAAGGAGCATGCCTGAAAAAATGGAGCAGCTTTGGAGGAATCCTTGGGTTGGAATGTGCAATGATTCTAGGGAGCACATG

ATACCAGAGCATCAATATCAGACATACAAGAACCTCTGCAACATCTTCCCTTCTAACATTGTTCTTGCAGTGATGGAGAAGAATCCCCACACAGCAGACG

CTCAACAACTGGCAGCCTTGATTGTTGCCAAGCTTAGAGCTGCACGTTGA
Translation
   - UNI38024 -   MEKGAIPPRCTNYR RFMPPDDPLGRHGPSLENFLRKRPVVPEHKKQPCPYG GKKCTYGHKCKYYHPERANQPQRSVADEL

RISAKLSTVKIMSEDTLAKCGAGMSTAKGEITSEIKRVASKRQSDPSIRSVAVEPEEWLSIARKPEASSVPSLVTALSVPTIPPPKSHAVGALNTRSASS

PVPGSSHFPHQKASLEHMVSMQYPPILVTNSHGTPINYTEQYPKFETMGDHDYY
Transcript ENSMUST00000082183
Sequence
AACTGCGCCGGGGCTGTGTGTGTAGGCAGCAGCGCCAGAGGAAGAGGAGCACGAGGATGCAGCTGCGACCGCGGCCCCAAGAGGGAGCAGCCACTGTTCT

GTGGTCGCGGGGCCAAAGCAATTGGAATTAAGCCTGGGGGGTCCTGTTGCTGAGAGGACCGGGGCAGACGGTCCTGCCAGAAGCGCAGGCCTAGTATTCC

GGGAGAGTTCGGTCTGCTGGGCGAAGGCCTGCCGCCTTTGCTTCCTCCTGGCCCTCCAAGTCGATGGTGGTGAAGTTGGTGGCCGCCAGGGGCACAAGCG

CCAGGCTGGTTCTCTTGCACCCGGCGCTTATCTGGCCCTGCTTGAACAGCTGCGACGCCGCCTCCTCTCTTCCGCGGATCCCACCCTCAGCGGCGGGGGA

GGGGGAAAGTTTTCCCCTCCGCAGGGGCTGCATGGTGCGAGGCGACAACAAGACCTTAGGAGAGTAGGG GAAGAAGCCAACAGTTGAGTTTGCTCCTGA

TTATACTCTGCTGAGCTGGACAGAGAGATCATGGAGA ATGCAACGTGACCAAATGTCTCATAATCCTGCTGCTGTATATTCACTGCCATGATGGACTGT

ATCCATTCAAACT - UNI38024 - GGTCTCCCTCTGTTGCCTATGGGGAGGGATATCTCTCCCAAGGCTCAAGGGAACCTCCTGTCTTGGCCTCCTG

AATTAATGGGACTTGAG AGACTGCTAACATCTGAACATACAAAACCAAACAGACAAAGTCTTGCACCATTGCTCCCCCCGCATTCTACTCTAGAGGAAT

GCCACTGTACATGGATTCCAAACAGGTTAAAAAGAAAAATAGCTGATTAGATCTCAGAGTACCCAGTGAACGGGATGACGGCCACAGCTGCAGTGGAGAC

ACCAAAAATGGAGAAGAGTGCTTCCAAGGAAGAGAAGCAACAGCCAAAGCAGGAGGACAGCACAGACCGAGGCAATGCTGATCCTGAAGAATGGGCGAAC

TCTGAGAGTGACCCTGAGCAGATGAGCTGTAAGAGTGGCCACACCAGCTACCAAGCCACAGATATTCAACTGAAGAAGAAAGAGATGCCCTCTAAGCCAC

ATCGTCCGCTCTGTCGGTCACCCTGCCTGGACCGGCCAAGCTTCTCCCAGAGCAGCATTTTACAGGATGGGAAGCTAGACTTGGAGAAAGAATACCAAGC

CAAGATGGATTTTGCTCTAAAGTTGGGTTATGCAGAAGAGCAAATTCAATCAGTGCTTAATAAACTAGGCCCAGAATCACTTATTAATGATGTATTAGCA

GAGCTTGTCAGACTTGGAAACAAAGGTGATTCGGAAGCACAAGTCAACTTGAGTCTATTACTGCCCCGAGGAGCAAGCTCCAGAGAGATTGCAAGCCCTG

AATTGTCTCTTGAAGATGAAATAGACAATAGTGATAATTTAAGACCAATTGTTATTGATGGAAGTAATGTGGCAATGAG CCATGGGAATAAAGAAGAAT

TCTCCTGCAGGGGAATACAACTTGCTGTGGATTGGTTTCTAGACAAAGGCCATAAAGATATCACGGTATTTGTACCAGCATGGAGAAAGGAGCAATCCCG

CCCCGATGCACCAATTACAG ATCAAGATATTCTACGTAAACTGGAGAAGGAAAAGATTCTCGTCTTCACACCATCGCGAAGGGTCCAAGGCAGGAGGGT

GGTCTGCTATGATGATCGGTTCATAGTCAAATTGGCTTTCGATTCTGATGGCATCATTGTGTCCAATGATAACTACCGAGACCTTCAAGTTGAAAAGCCA

GAATGGAAGAAGTTTATAGAGGAACGGTTGCTGATGTATTCTTTTGTGAATGATAA ATTTATGCCGCCAGATGATCCTCTTGGACGCCATGGTCCGAGC

CTTGAGAATTTCTTAAGAAAGAGACCTGTGGTTCCTGAGCATAAGAAGCAGCCATGTCCTTATG GCAAAAAATGTACCTACGGCCACAAGTGCAAATAC

TATCATCCGGAGCGGGCCAACCAACCCCAGCGTTCGGTGGCTGATGAGCTCCGCATCAGTGCCAAACTGTCCACAGTGAAAATAATGAGTGAAGACACCC

TGGCCAAATGTGGCGCAGGGATGTCTACTGCCAAAGGTGAGATAACCTCAGAGATAAAACGTGTGGCCTCCAAGCGCCAATCAGATCCCAGCATCCGGTC

TGTGGCTGTAGAGCCTGAGGAGTGGCTGTCCATCGCCCGTAAACCTGAGGCCAGTTCTGTCCCTTCACTTGTGACCGCTTTAAGTGTCCCTACAATCCCT

CCTCCCAAAAGCCATGCAGTGGGTGCACTCAACACCCGTTCAGCCAGCAGCCCAGTGCCAGGGTCCTCCCATTTTCCCCATCAAAAGGCCTCTTTGGAAC

ACATGGTCAGCATGCAATATCCACCTATCCTGGTTACCAACAGCCATGGCACCCCTATTAACTATACTGAGCAATACCCAAAGTTTGAGACCATGGGGGA

CCATGACTACTATTCAGTGTTAAGTGACTTCTCCAAACTGAGCATCAACAACATGCATAATCATGAATATTATATGGCTGAGGCAAACCAGGGGGTATAT

GTTCGGAATCCCGGCCTATGTACTGATAGTCACATGAGCCATACCAGGAATGACAACTATTCCTCTTACAACAACCTGTACTTGGCTGTAGCTGATGCCC

ATCCTGAAGGCACTTTGAAGCTGCACCGCTCAGCATCTCATAACCATCTTCAGCCTTTTTCCCATGGTTACCATGAAGCCTTAGCAAGAGTTCAAAGTTA

TGGTTCCGAAGATTCCAAGCAAGCACCCCACAAGCAGTCAGTCCCTCACTTAGCTGTGCATACCCAGAATCCAGCAACTGGAGCACACTCTAGCTGTCCT

GGAGACTACACCATGCCTCCCAGTATCCATCCTGTGGGACCCTCCCAGCCAGGCCGGGCTCTGGTGATGACTCGAATGGACAGCATTTCTGACTCCCGCC

TCTATGACAGCAACCCCATGAGGCAAAGACGGCCTCCTCTGTGCAGAGAACAGCATGCTAGCTGGGACCCATTGCCTTGTACAGCCGACTCCTATGGATA

CCACTCCTATCCCTTAGGGAACAGCCTCATGCAACCGTGTTATGAACCAGTCATGGTAAGGAGCATGCCTGAAAAAATGGAGCAGCTTTGGAGGAATCCT

TGGGTTGGAATGTGCAATGATTCTAGGGAGCACATGATACCAGAGCATCAATATCAGACATACAAGAACCTCTGCAACATCTTCCCTTCTAACATTGTTC

TTGCAGTGATGGAGAAGAATCCCCACACAGCAGACGCTCAACAACTGGCAGCCTTGATTGTTGCCAAGCTTAGAGCTGCACGTTGA
Translation
   - UNI38024 -  MTATAAVETPKMEKSASKEEKQQPKQEDSTDRGNADPEEWANSESDPEQMSCKSGHTSYQATDIQLKKKEMPSKPHRPLCRSP

CLDRPSFSQSSILQDGKLDLEKEYQAKMDFALKLGYAEEQIQSVLNKLGPESLINDVLAELVRLGNKGDSEAQVNLSLLLPRGASSREIASPELSLEDEI

DNSDNLRPIVIDGSNVAMS SHGNKEEFSCRGIQLAVDWFLDKGHKDITVFVPAWRKEQSRPDAPITD DQDILRKLEKEKILVFTPSRRVQGRRVVCYD

DRFIVKLAFDSDGIIVSNDNYRDLQVEKPEWKKFIEERLLMYSFVNDK KFMPPDDPLGRHGPSLENFLRKRPVVPEHKKQPCPYG GKKCTYGHKCKYY

HPERANQPQRSVADELRISAKLSTVKIMSEDTLAKCGAGMSTAKGEITSEIKRVASKRQSDPSIRSVAVEPEEWLSIARKPEASSVPSLVTALSVPTIPP

PKSHAVGALNTRSASSPVPGSSHFPHQKASLEHMVSMQYPPILVTNSHGTPINYTEQYPKFETMGDHDYYSVLSDFSKLSINNMHNHEYYMAEANQGVYV

RNPGLCTDSHMSHTRNDNYSSYNNLYLAVADAHPEGTLKLHRSASHNHLQPFSHGYHEALARVQSYGSEDSKQAPHKQSVPHLAVHTQNPATGAHSSCPG

DYTMPPSIHPVGPSQPGRALVMTRMDSISDSRLYDSNPMRQRRPPLCREQHASWDPLPCTADSYGYHSYPLGNSLMQPCYEPVMVRSMPEKMEQLWRNPW

VGMCNDSREHMIPEHQYQTYKNLCNIFPSNIVLAVMEKNPHTADAQQLAALIVAKLRAAR

For any suggestions or comments, please send an email to unitrap@crg.es