Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035049 (Rrp12)
Chromosomal location
Chr 19: 41937346 - 41970663 (-)
Description
ribosomal RNA processing 12 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:2147437]
RefSeq_dna
NM_199447 
RefSeq_peptide
NP_955518.1 
MGI
MGI:2147437 
Uniprot/SWISSPROT
Q6P5B0 
Uniprot/SPTREMBL
Q3UJA1 
Human Ortholog
ENSG00000052749 (RRP12)
Omim not available
UniTrap UNI5591
Vector Insertion
Chr 19: 41969868 - 41970428
Public Clones YTA296 (baygenomics) XH708 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33100
Vector Insertion
Chr 19: 41961500 - 41964373
Public Clones IST13733F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5983
Vector Insertion
Chr 19: 41948832 - 41949018
Public Clones CSH398 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4970
Vector Insertion
Chr 19: 41947557 - 41948232
Public Clones XS0954 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38457
Vector Insertion
Chr 19: 41945624 - 41946080
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11825
Vector Insertion
Chr 19: 41943310 - 41945299
Public Clones A067A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038677
Sequence
AGGACACACACGTGGGTTCTGCCGTGGCTTCTGCTGTCTTTTCGGCGTGTGTGGACGCTTGTTCTCTGGGCGAGTGCGAGCCACCGTTTGGTCAACATGG

GTCGCTCGGGGAAATTGCCCTCTGGTGTCTCGGCCAAGTTGAAGCGCTGGAAGAAAGGCCACAGCAGCGACAGCAACCCCGCCACTTGCCGCCATCGCCA

GGCCGCTCGGAGCCGCTTCTTCAGCCGCCCGTCAG - UNI5591 - GAAAGAGCGACCTGACTGTTGATGCTGTGAAGTTGCATAATGAGCTGCAGTC

GGGGACCCTGAGCCTGGGCAAAAGCCAAGCCCCTGAGACGACCATGGACCAAGATCCAGAGGTGGCTTTCACCGAGAAGTCCTCGGGCACGTTTCTGAGT

GGCTTGTCTGACTGTACAAATGTCACTTTCAGCAAAGTGCAGCGCTTCTGGGAATCCAACTCAGCTGCTCACAAGGAG ATCTGCGCTGTGCTGGCTGCT

GTTACAGAGGTGATTCGATCCCAGGGAGGCAAGGAGACGGAGACCGAGTACTTTGCTGCTCTG ATGACAACAATGGAAGCAGTGGAGTCCCCAGAGTCA

CTGGCTGCCGTTGCATACCTATTGAACCTTGTCCTGAAGCG GGTGCCAAGTCCTGTGCTCATGAAGAAGTTCTCTGATACCTCCAAAGCCTTCATGGAC

ATCATGTCTGCGCAGGCGAGCAGTGGCTCCACCTCTGCTCTCCGATGG - UNI33100 - GTCCTCTCCTGCCTGGCCATCCTCCTTCGGAAGCAAGA

CCTGGAGGCCTGGGGCTATCCCATCACCCTTCAGGTGTACCATGGACTGCTGAGCTTCACCGTGCATGCCAAGCCGAAG - UNI33100 - ATCCGTA

AGGCTGCTCAGCACGGAGTGTGCTCAGTTCTCAAGGGCAGTGACTTCATGTTTGGTGAAAAGGCCCCTGCCCATCATCCTGCTGCCGTCTCCACTGCCAA

GTTCTGCATCCAGGAGATTGAGAAGTCTGGAG - UNI33100 - GTTCCAAAGAGGCCACCACCACGCTGCATATGCTAACACTGCTGAAGGACATGC

TGCCCTGCTTCCCGGAAGGCCTGGTGAAGAGCTGCAGTGAGACTCTGCTTCGGGTCATGACCTTGAACCATGTG CTTGTGACAGCCTGTGCCATGCAGG

CCTTCCATAACCTCTTCCATGCCAAGCCCAGCCCTAGCACCCTGTCAGCAGAACTCAACGCCCAGATCGTCACG GCACTATATGACTACGTTCCCAGTG

AGAATGATTTACAGCCCCTGCTGGCCTGGCTTAAGGTCATGGAGAAAGCCCACATCAACCTGGTCAG GCTGCAGCGAGACCTGGGGCTAGGCCATCTTG

CTCGATTTTTCGGAACCGCAGTGACCTGTCTTCTCTCGCCTCATTCACAAGTGGCGGCGGCTGCTACCCAGACTCTCAAG GAGATCCTGAAGGAGTGTG

TGGCTCCACACATTGCTGACATTGGCTCTGTGACCTCTTCAGCCTCAGGTCCTCCCCAGTACATCACTAAGATGTTCAG GGCAGTGGAAGAGGGCCTCA

CATACAAATTTCATGCAGCCTGGAGCTCTGTGCTGCAGCTCCTGGGGGTCTTCTTTGAAGCTTGCGGAAAGCAGGCCCATCCTGTGATGAAGAAG TGCC

TCCAGTCCCTGTGTGACCTGCGCCTCTCTCCTCACTTCCCCCACACAGCAGCCCTGGACCAGGCTGTAGGGGCTGCAGTGACCAGCATGGGTCCCGAGGT

GGTGTTGCAGGCCGTGCCCTTGGAAATCGATGGCTCTGA GGAGACTCTGGATTTCCCACGGAGCTGGCTGCTGCCTGTCATCCGGGATCATGTTCGGGA

AACCAGGCTTGGTTTCTTCACCACTTACTTCTTGCCCTTGGCCACCACTCTTAAGAGAAAAG CAATGGACCTGGCTCAGGCAGGCAGCACAGTGGAGTC

GAAGATTTATGATACACTCCAGTGGCAG ATCTGGACCCTCCTGCCTGGGTTCTGCACAAGGCCCACAGATGTGGCTGCCTCCTTCAAAGGCCTGGCACG

GACTCTGGGCACAGCTATCAATGAACGCCCAGACCTGAGGGTCACTGTGTGCCAGGCCCTACGTACCCTCATCACTAAGGGCTGTGAGGCAG AGGCTGA

CCGAGCTGAAGTGAGCCGCTTTGCCAAAAACTTCCTGCCAATCCTCTTCAACCTGTATGGGCAGCCTGTTGCAGCTGGAGAGGCGGCAGCCCCTCGCCGT

GCTGTGCTGGAAACCATCAAAACTTACCTCACCATAACTGAGGCTCAG TTGGTGAATAGCTTCCTGGAAAAAGCCACCGAGAAGGTTCTCGATCCTGCC

AGCTCTGATTTCACCAG ATTGTCTGTCCTGGATCTGGTTGTGGCTTTGGCTCCTTACTCGGATGAAGCTGCCATCAGTAAGCTATACTCTACCATCCGG

CCCTACCTTGAG AGCAAGGTCCACGGTGTACAGAAGAAGGCCTACCGCGTGCTGGAGGAGGTGTGTGCCAGTTCTCAGGGCCCGGCAGCCCGCTTCGTG

CAGAGCCACCTGGATGATCTGAAGAAGACTCTGCTGGACTCGCTTCGGACCACATCCTCGCCTGCTAAAAGG CCCCGTTTGAAGTGCCTCATACATATT

GTGAAGACGCTGTCGGCTGAGCATGAGGAGTTCATAGCTGCCCTCATCCCAGAG - UNI5983 - GTGATCCTGTGCACCAAGGAGGTGTCAGTGGGT

GCAAGGAAGAGTGCGTTTACCTTGCTGGTGGAGATGGGCCATGCTTTCCTGCGATTTGGCTCCAACCAGGAAG ACGCTCTGCAGCGGTACCTTGTCCTC

ATCTATCCTGGCCTTCTGGGTGCAGTTACCACAGTTAGTTGCAGCATTTTGGCTCTGACCCACCTCTTGTTTGAGTTCAAAG - UNI4970 - GGCTG

ATGGGGACCAGCACAGTGGAGCAGCTCCTGGAGAACGTGTGCCTGCTGCTGGCCTCTCGAACCCGTGATGTGGTCAAGTCCGCGCTAGGCTTCATCAAGG

TTGCTGTGGTGGTCATGGACGTGGTGCACCTTGCTAAGCATGTGCAGCTAGTG ATGGAAGCCATTGGGAAGTTGTCAGATGACATGCGACGGCACTTCC

GGATGAAGCTTCGGAACCTGTTCATCAAGTTCACCCGCAAGTTTGG ATTCGAGTTGGTGAAGGGTCTGCTACCCGCAGAATACCACAAAGTCCTGATAA

ACATCAGGAAAGCTGAGACCCGAGCCAAGAAGCATCGTGCCCTGAGCCAGGCTGCTGTAGAGGAGGAGGAAGAGGAGGAAGAGGAAGAGGAGCCTGTCCA

GAGCAAAGGTGACAG CATTGAGGAGATTTTGGCTGACTCTGAGGATGAGGATGAGGAAGAAGAAAGAGGCCGGGGCAAGGAGCAGCGGAAGCTGGCACG

ACAGAGGAGCCGGGCATGGCTGAAGGAAGGTGGTGGCGATGAGCCCCTCAACTTCCTGGATCCCAAGGTGGCCCATCGAGTCCTTG CCACCCAGCCTGG

GCCTGGGCGGGGCAAGAAGAGGGACCATGGCTTCAAGTTGAGTGCTGATGGCCGGCTGATCATACGGGAGGAGGAAGATGGAAACAAGGTGGAGGAAGAA

GATGGCACTAAAG - UNI11825 - GGGAAGATGAAGACATGACCGATGCGATGGAGGATGCCAGTGTGAGAAGT AAAAAGAAGCTTAAGCGGCAGA

GGGAGGACGAGGAGGATGAGCTGGAGATCCCACCTCGGTACCAAG CTGGAGGCTCTGGCATCCATCGCCCTGTGGCTAAGAAGGCTGCACCTGGAGCTG

AATACAAGGCCAAG AAGGCAAAAGGCGATGTAAAGAAGAAGGGCCGCCTGGATCCCTATGCGTACGTTCCACTCAACAGATCCAAGCTCAACCGCAG G

AAGAAGGTGAAGCTCCAGGGGCAGTTTAAAGGTCTGGTGAAAGCCACCCAGCGGGGATCCCAGGCGGGACACAAACTCCGCAGAAAGGATCGGCGGCGGC

CCTGAATCCCTCTGGGGAATGGAGCTGTTCTCTGCTGTGGTCCAGGGCCCCTTTCTAACTCCCATGATGTTTAACACCAACTCCAGGTGTGAGCCTTGCT

AAACCTGGACAGAGAATGACTCATTGGAAGCAGGACTCATTTCTAAGAGAGATAGATGCCTAGGATTTTGGAAACTATTGTCCTTTGGAGACATTGCCAA

CATCTAGGAGTGGAAATGTGACGTCGCTACCTCTGAGAAGGCCTTAAGTGGTGCTCTGCTTTCTGTCCAATGTGGCCATGAGAGCAGAGTGATGACTGTG

GTCTGCGTGTGTAAGATCTGCTCTAACCAGGCGTAGAATAAATGTGCATGACCATG
Translation
MGRSGKLPSGVSAKLKRWKKGHSSDSNPATCRHRQAARSRFFSRPSG - UNI5591 - GKSDLTVDAVKLHNELQSGTLSLGKSQAPETTMDQDPEVA

FTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKE ICAVLAAVTEVIRSQGGKETETEYFAAL MTTMEAVESPESLAAVAYLLNLVLKR RVPSPV

LMKKFSDTSKAFMDIMSAQASSGSTSALRW - UNI33100 - VLSCLAILLRKQDLEAWGYPITLQVYHGLLSFTVHAKPK - UNI33100 - IRK

AAQHGVCSVLKGSDFMFGEKAPAHHPAAVSTAKFCIQEIEKSGG - UNI33100 - GSKEATTTLHMLTLLKDMLPCFPEGLVKSCSETLLRVMTLNH

V LVTACAMQAFHNLFHAKPSPSTLSAELNAQIVT ALYDYVPSENDLQPLLAWLKVMEKAHINLVR RLQRDLGLGHLARFFGTAVTCLLSPHSQVAAA

ATQTLK EILKECVAPHIADIGSVTSSASGPPQYITKMFR RAVEEGLTYKFHAAWSSVLQLLGVFFEACGKQAHPVMKK CLQSLCDLRLSPHFPHTAA

LDQAVGAAVTSMGPEVVLQAVPLEIDGSE EETLDFPRSWLLPVIRDHVRETRLGFFTTYFLPLATTLKRKA AMDLAQAGSTVESKIYDTLQWQ IWTL

LPGFCTRPTDVAASFKGLARTLGTAINERPDLRVTVCQALRTLITKGCEAE EADRAEVSRFAKNFLPILFNLYGQPVAAGEAAAPRRAVLETIKTYLTI

TEAQ LVNSFLEKATEKVLDPASSDFTR RLSVLDLVVALAPYSDEAAISKLYSTIRPYLE SKVHGVQKKAYRVLEEVCASSQGPAARFVQSHLDDLKK

TLLDSLRTTSSPAKR PRLKCLIHIVKTLSAEHEEFIAALIPE - UNI5983 - VILCTKEVSVGARKSAFTLLVEMGHAFLRFGSNQED DALQRYL

VLIYPGLLGAVTTVSCSILALTHLLFEFKG - UNI4970 - GLMGTSTVEQLLENVCLLLASRTRDVVKSALGFIKVAVVVMDVVHLAKHVQLV MEA

IGKLSDDMRRHFRMKLRNLFIKFTRKFG GFELVKGLLPAEYHKVLINIRKAETRAKKHRALSQAAVEEEEEEEEEEEPVQSKGDS SIEEILADSEDED

EEEERGRGKEQRKLARQRSRAWLKEGGGDEPLNFLDPKVAHRVLA ATQPGPGRGKKRDHGFKLSADGRLIIREEEDGNKVEEEDGTKG - UNI11825

 - GEDEDMTDAMEDASVRS KKKLKRQREDEEDELEIPPRYQA AGGSGIHRPVAKKAAPGAEYKAK KAKGDVKKKGRLDPYAYVPLNRSKLNRR RK

KVKLQGQFKGLVKATQRGSQAGHKLRRKDRRRP

For any suggestions or comments, please send an email to unitrap@crg.es