Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035064 (Eef2k)
Chromosomal location
Chr 7: 127986369 - 128047508 (+)
Description
eukaryotic elongation factor-2 kinase Gene [Source:MGI (curated);Acc:Eef2k-001]
RefSeq_dna
NM_007908 
RefSeq_peptide
NP_031934.1 
UniGene
Mm.469606 Mm.25997 
MGI
MGI:1195261 
Uniprot/SWISSPROT
O08796 
Uniprot/SPTREMBL
Q7TPC7 Q8BNP6 Q8CEC8 Q3UWZ1 
Human Ortholog
ENSG00000103319 (EEF2K)
Omim not available
UniTrap UNI25684
Vector Insertion
Chr 7: 127994884 - 128001857
Public Clones not available
Private Clones OST170518 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13342
Vector Insertion
Chr 7: 128043887 - 128046795
Public Clones CMHD-GT_329C9-3 (cmhd) CMHD-GT_498F5-3 (cmhd) CMHD-GT_173C3-3 (cmhd) CMHD-GT_173A8-3 (cmhd)
Private Clones OST24237 (lexicon) OST7551 (lexicon) OST5416 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047875
Sequence
GCCTCCAGCCTCCAGCTCCAACCCCAGCGGCAGCAGCCCCAACTCCAGCCCGTGCTCGGCTCCAGCGCTCCGACGTCTTCAGGCGCCCCACTGCGGCTGC

GGGCCTGGCTCTCTGTCGCCTGCGCTTTGTACCGGGGATTCTCCTCCCTCCCTGCACCCTGGAGCGCCCGGCCGCCAGCCTTTGCCAGCTCCTTGGGATC

CTTGCGGCCGTGGGCAGCAGCTGTCGCGCCTGCCACACTGTGGGAG - UNI25684 - GACCATCCTTGCTGCACGTGCGCAGTAACTCTGGCTGCAC

AGCGGAGCCCCCGGATAACACGGTCGCCCCCGCAACATGGCAGACGAAGACCTCATCTTCTGCCTGGAAGGTGTTGACGGTGGCAGGTGCTCCCGAGCTG

GCCACAATGCGGACTCTGACACAGACAGTGACGATGATGAGGGCTATTTCATCTGCCCCATCACTGATGACCACATGTCCAATCAGAATGTCAGCTCCAA

AGTCCAGAGCTACTATAGCAACCTAACAAAAACAGAGTGCGGCTCCACAGGGTCACCAGCCAGCTCCTTCCACTTCAAG GAAGCCTGGAAGCATGCGAT

CGAGAAAGCCAAGCACATGCCTGACCCCTGGGCTGAATTCCATCTCGAGGACATCGCCACAGAACATGCTACTCGGCACAG GTACAACGCTGTCACCGG

GGAATGGCTGAAAGACGAGGTTCTGATCAAGATGGCGTCTCAG CCCTTCGGCCGTGGAGCAATGAGGGAGTGCTTCAGGAC GAAGAAACTCTCCAACT

TCTTGCACGCCCAGCAATGGAAGGGGGCCTCCAACTACGTGGCCAAGCGCTACATCGAGCCGGTGGACAGGAGCGTGTACTTTGAGGATGTGCAGCTCCA

GATGGAGGCGAAGCTCTGGGGGGAGGATTACAATCGGCACAAGCCCCCCAAGCAG GTGGATATCATGCAGATGTGCATCATTGAGCTAAAGGACAGACC

AGGCCAGCCCCTCTTCCACTTGGAGCACTACATTGAGGGCAAGTACATCAAGTACAATTCCAACTCAGGCTTTGTCCGTGATGACAACATCCGACTAACC

CCACAG GCCTTCAGCCATTTCACATTTGAGCGTTCTGGTCATCAGCTGATTGTAGTGGACATCCAGGGTGTGGGTGACCTTTATACCGACCCACAGATC

CACACTGAGAAAGGCACTGACTTTGGAGATGGTAACCTTG GTGTCCGGGGAATGGCTCTCTTCTTCTACTCTCATGCCTGCAACCGGATTTGTCAGAGC

ATGGGCCTTACGCCCTTTGACCTCTCCCCACGGGAACAGGATGCGGTGAATCAGAGCACCAGGCTATTG CAATCAGCCAAGACCATCTTGAGGGGGACA

GAGGAGAAGTGTGGGAGTCCCCGCATAAGGACACTCTCTAGCAGCCGGCCCCCTTTGCTCCTTCGCCTGTCAGAGAACTCCGGGGATGAGAACATGAGTG

ACGTGACCTTTGACTCTCTGCCTTCCTCCCCGTCTTCAGCTACACCACACAGCCAGAAACTGGACCACCTCC ATTGGCCAGTGTTTGGTGACCTCGATA

ACATGGGCCCTAGAGACCATGACCGCATGGACAATCACCGG GACTCTGAGAATAGTGGGGACAGTGGGTATCCAAGCGAGAAGCGAAGTGACCTGGATG

ATCCTGAGCCCCGAGAACAC GGCCACTCCAACGGCAACCGAAGGCATGAATCTGACGAGGATAGCCTGGGCAGCTCTGGACGG GTCTGTGTGGAGACG

TGGAACCTGCTCAATCCCTCCCGCCTGCACCTGCCGAGGCCCTCGGCCGTGGCCCTAGAAGTGCAGAGGCTAAATGCCCTGGACCTTGGAAGGAAAATCG

GGAAGTCTGTTTTGGGGAAG GTCCATTTGGCCATGGTGCGATACCACGAGGGCGGGCGCTTCTGCGAGAAGGATGAGGAGTGGGATCGAGAGTCAGCCA

TCTTCCATCTGGAGCATGCAGCTGACCTGGGAGAACTGGAGGCCATCGTGGGCCTAGGCCTCATGTACTCTCAGCTGCCCCACCACATCCTGGCTGATGT

CTCTCTGAAG GAGACAGAGGAGAACAAGACAAAAGGCTTTGATTACTTACTGAAGGCGGCAGAAGCTGGTGACAGGCATTCCATGATTTTAGTGGCCCG

AGCTTTTGACACTGGCCTGAACCTCAGCCCAGACAG GTGTCAAGACTGGTCGGAAGCCTTGCACTGGTACAACACAGCCCTGGAGACAACAGACTGCGA

TGAAGGCGGGGAGTACGATGGGATACAGGACGAGCCCCAGTACGCACTGCTGGCCAGGGAGGCGGAGATGCTGCTCACCGGGGGATTTGGACTGGACAAG

AACCCCCAAAGATCAG - UNI13342 - GAGATTTGTACACCCAGGCAGCTGAGGCAGCAATGGAAGCCATGAAGGGCCGGCTAGCCAACCAGTACTA

CGAGAAGGCGGAAGAGGCCTGGGCCCAGATGGAGGAATAACTGCCCCACAGAATCACTGCCAAGGAGAAAGGCTGGGGAAGGGAGGATGGGACTCATTTC

TAGGGAGGGGAGAAGCAGTTTTATTATGGTATAAACTCACTTTTGT
Translation
 - UNI25684 - MADEDLIFCLEGVDGGRCSRAGHNADSDTDSDDDEGYFICPITDDHMSNQNVSSKVQSYYSNLTKTECGSTGSPASSFHFK EAWK

HAIEKAKHMPDPWAEFHLEDIATEHATRHR RYNAVTGEWLKDEVLIKMASQ PFGRGAMRECFRT TKKLSNFLHAQQWKGASNYVAKRYIEPVDRSVY

FEDVQLQMEAKLWGEDYNRHKPPKQ VDIMQMCIIELKDRPGQPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQ AFSHFTFERSGHQLIVVDIQGVG

DLYTDPQIHTEKGTDFGDGNLG GVRGMALFFYSHACNRICQSMGLTPFDLSPREQDAVNQSTRLL QSAKTILRGTEEKCGSPRIRTLSSSRPPLLLRL

SENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLH HWPVFGDLDNMGPRDHDRMDNHR DSENSGDSGYPSEKRSDLDDPEPREH GHSNGNRRHESDE

DSLGSSGR VCVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGK VHLAMVRYHEGGRFCEKDEEWDRESAIFHLEHAADLGELEAIVGL

GLMYSQLPHHILADVSLK ETEENKTKGFDYLLKAAEAGDRHSMILVARAFDTGLNLSPDR RCQDWSEALHWYNTALETTDCDEGGEYDGIQDEPQYAL

LAREAEMLLTGGFGLDKNPQRSG - UNI13342 - GDLYTQAAEAAMEAMKGRLANQYYEKAEEAWAQMEE
Transcript ENSMUST00000106489
Sequence
CAGCTGCGCCCTGTGTGTGACTGATCGCGTGCGTTTCGGAAGAGTGAGATCTGACTTGGGAATTCTCCTTGGGGGAGTATTTCTGCGTCCTCCGCGATGA

GGCGCTCCCTGGCTTGGGACCACTGAACAGATATTACGGAGGAGAAAGCCGAGGTCCAGAGTGGACCCCAGATCCTCAGAGGCCAG - UNI25684 - 

GACCATCCTTGCTGCACGTGCGCAGTAACTCTGGCTGCACAGCGGAGCCCCCGGATAACACGGTCGCCCCCGCAACATGGCAGACGAAGACCTCATCTTC

TGCCTGGAAGGTGTTGACGGTGGCAGGTGCTCCCGAGCTGGCCACAATGCGGACTCTGACACAGACAGTGACGATGATGAGGGCTATTTCATCTGCCCCA

TCACTGATGACCACATGTCCAATCAGAATGTCAGCTCCAAAGTCCAGAGCTACTATAGCAACCTAACAAAAACAGAGTGCGGCTCCACAGGGTCACCAGC

CAGCTCCTTCCACTTCAAG GAAGCCTGGAAGCATGCGATCGAGAAAGCCAAGCACATGCCTGACCCCTGGGCTGAATTCCATCTCGAGGACATCGCCAC

AGAACATGCTACTCGGCACAG GTACAACGCTGTCACCGGGGAATGGCTGAAAGACGAGGTTCTGATCAAGATGGCGTCTCAG CCCTTCGGCCGTGGAG

CAATGAGGGAGTGCTTCAGGAC GAAGAAACTCTCCAACTTCTTGCACGCCCAGCAATGGAAGGGGGCCTCCAACTACGTGGCCAAGCGCTACATCGAGC

CGGTGGACAGGAGCGTGTACTTTGAGGATGTGCAGCTCCAGATGGAGGCGAAGCTCTGGGGGGAGGATTACAATCGGCACAAGCCCCCCAAGCAG GTGG

ATATCATGCAGATGTGCATCATTGAGCTAAAGGACAGACCAGGCCAGCCCCTCTTCCACTTGGAGCACTACATTGAGGGCAAGTACATCAAGTACAATTC

CAACTCAGGCTTTGTCCGTGATGACAACATCCGACTAACCCCACAG GCCTTCAGCCATTTCACATTTGAGCGTTCTGGTCATCAGCTGATTGTAGTGGA

CATCCAGGGTGTGGGTGACCTTTATACCGACCCACAGATCCACACTGAGAAAGGCACTGACTTTGGAGATGGTAACCTTG GTGTCCGGGGAATGGCTCT

CTTCTTCTACTCTCATGCCTGCAACCGGATTTGTCAGAGCATGGGCCTTACGCCCTTTGACCTCTCCCCACGGGAACAGGATGCGGTGAATCAGAGCACC

AGGCTATTG CAATCAGCCAAGACCATCTTGAGGGGGACAGAGGAGAAGTGTGGGAGTCCCCGCATAAGGACACTCTCTAGCAGCCGGCCCCCTTTGCTC

CTTCGCCTGTCAGAGAACTCCGGGGATGAGAACATGAGTGACGTGACCTTTGACTCTCTGCCTTCCTCCCCGTCTTCAGCTACACCACACAGCCAGAAAC

TGGACCACCTCC ATTGGCCAGTGTTTGGTGACCTCGATAACATGGGCCCTAGAGACCATGACCGCATGGACAATCACCGG GACTCTGAGAATAGTGGG

GACAGTGGGTATCCAAGCGAGAAGCGAAGTGACCTGGATGATCCTGAGCCCCGAGAACAC GGCCACTCCAACGGCAACCGAAGGCATGAATCTGACGAG

GATAGCCTGGGCAGCTCTGGACGG GTCTGTGTGGAGACGTGGAACCTGCTCAATCCCTCCCGCCTGCACCTGCCGAGGCCCTCGGCCGTGGCCCTAGAA

GTGCAGAGGCTAAATGCCCTGGACCTTGGAAGGAAAATCGGGAAGTCTGTTTTGGGGAAG GTCCATTTGGCCATGGTGCGATACCACGAGGGCGGGCGC

TTCTGCGAGAAGGATGAGGAGTGGGATCGAGAGTCAGCCATCTTCCATCTGGAGCATGCAGCTGACCTGGGAGAACTGGAGGCCATCGTGGGCCTAGGCC

TCATGTACTCTCAGCTGCCCCACCACATCCTGGCTGATGTCTCTCTGAAG GAGACAGAGGAGAACAAGACAAAAGGCTTTGATTACTTACTGAAGGCGG

CAGAAGCTGGTGACAGGCATTCCATGATTTTAGTGGCCCGAGCTTTTGACACTGGCCTGAACCTCAGCCCAGACAG GTGTCAAGACTGGTCGGAAGCCT

TGCACTGGTACAACACAGCCCTGGAGACAACAGACTGCGATGAAGGCGGGGAGTACGATGGGATACAGGACGAGCCCCAGTACGCACTGCTGGCCAGGGA

GGCGGAGATGCTGCTCACCGGGGGATTTGGACTGGACAAGAACCCCCAAAGATCAG - UNI13342 - GAGATTTGTACACCCAGGCAGCTGAGGCAG

CAATGGAAGCCATGAAGGGCCGGCTAGCCAACCAGTACTACGAGAAGGCGGAAGAGGCCTGGGCCCAGATGGAGGAATAACTGCCCCACAGAATCACTGC

CAAGGAGAAAGGCTGGGGAAGGGAGGATGGGACTCATTTCTAGGGAGGGGAGAAGCAGTTTTATTATGGTATAAACTCACTTTTGTATTCCGTTTTCTCA

CTCTTGATAGCCTTTGCAGCTGGCCGAGACATTATAACTGCCCTTTTAGTGGTGGTACTTTGGGGGAAGTGGGGGGTTGAAGATGCAGCCTAATGAGTCT

CTTTCCCGTCCTCCACCCCCCGGTTTTCCCTTTTTCATCCTGAGATGTAAGCAAGTATCTTTCTGTCTGGATGATCAGACAGTATCAGGGCTTCTCTCGC

CAGCCTTTGCAGGCAGGACTCACATCTCAGGGTCTCCAGGCCATGTGCTGGGAAACCTTTCTATTGGCTTTCCACAATGGGTCTTTCTTTCAGTTTTGAG

AGCGGTATGTTGTTTTTTTGTTTGTTTCCTCCAGTGGATGTGAGATGGTTCAATACCCAGGCTCCTTCATGCTGGGGGAGATAGTTGTATAACTTTCACT

TAATGCCCTTCCACTGGACATGTGATTCCTGGCATCCTTCTAAATTTTTTTTTTTTAGACCTGCTATGTAATATAGATTTTTC
Translation
 - UNI25684 - MADEDLIFCLEGVDGGRCSRAGHNADSDTDSDDDEGYFICPITDDHMSNQNVSSKVQSYYSNLTKTECGSTGSPASSFHFK EAWK

HAIEKAKHMPDPWAEFHLEDIATEHATRHR RYNAVTGEWLKDEVLIKMASQ PFGRGAMRECFRT TKKLSNFLHAQQWKGASNYVAKRYIEPVDRSVY

FEDVQLQMEAKLWGEDYNRHKPPKQ VDIMQMCIIELKDRPGQPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQ AFSHFTFERSGHQLIVVDIQGVG

DLYTDPQIHTEKGTDFGDGNLG GVRGMALFFYSHACNRICQSMGLTPFDLSPREQDAVNQSTRLL QSAKTILRGTEEKCGSPRIRTLSSSRPPLLLRL

SENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLH HWPVFGDLDNMGPRDHDRMDNHR DSENSGDSGYPSEKRSDLDDPEPREH GHSNGNRRHESDE

DSLGSSGR VCVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGK VHLAMVRYHEGGRFCEKDEEWDRESAIFHLEHAADLGELEAIVGL

GLMYSQLPHHILADVSLK ETEENKTKGFDYLLKAAEAGDRHSMILVARAFDTGLNLSPDR RCQDWSEALHWYNTALETTDCDEGGEYDGIQDEPQYAL

LAREAEMLLTGGFGLDKNPQRSG - UNI13342 - GDLYTQAAEAAMEAMKGRLANQYYEKAEEAWAQMEE
Transcript ENSMUST00000106488
Sequence
GATTCACCGGGCTCCTTCTGAACTTACACAGACAGTGAGCAGGTGCTGGGAAAACAGGCACTGCGGCCAGCAAGGCAGGTCACAAGGTAGGCAAGGAGAT

CAGGGTTGCAGCTTTCCTGAGTCCTCAACCGTGCTGGGGCTGGCTTTAGATGATGCAGCTGCTGCTCCT - UNI25684 - GACCATCCTTGCTGCAC

GTGCGCAGTAACTCTGGCTGCACAGCGGAGCCCCCGGATAACACGGTCGCCCCCGCAACATGGCAGACGAAGACCTCATCTTCTGCCTGGAAGGTGTTGA

CGGTGGCAGGTGCTCCCGAGCTGGCCACAATGCGGACTCTGACACAGACAGTGACGATGATGAGGGCTATTTCATCTGCCCCATCACTGATGACCACATG

TCCAATCAGAATGTCAGCTCCAAAGTCCAGAGCTACTATAGCAACCTAACAAAAACAGAGTGCGGCTCCACAGGGTCACCAGCCAGCTCCTTCCACTTCA

AG GAAGCCTGGAAGCATGCGATCGAGAAAGCCAAGCACATGCCTGACCCCTGGGCTGAATTCCATCTCGAGGACATCGCCACAGAACATGCTACTCGGC

ACAG GTACAACGCTGTCACCGGGGAATGGCTGAAAGACGAGGTTCTGATCAAGATGGCGTCTCAG CCCTTCGGCCGTGGAGCAATGAGGGAGTGCTTC

AGGAC GAAGAAACTCTCCAACTTCTTGCACGCCCAGCAATGGAAGGGGGCCTCCAACTACGTGGCCAAGCGCTACATCGAGCCGGTGGACAGGAGCGTG

TACTTTGAGGATGTGCAGCTCCAGATGGAGGCGAAGCTCTGGGGGGAGGATTACAATCGGCACAAGCCCCCCAAGCAG GTGGATATCATGCAGATGTGC

ATCATTGAGCTAAAGGACAGACCAGGCCAGCCCCTCTTCCACTTGGAGCACTACATTGAGGGCAAGTACATCAAGTACAATTCCAACTCAGGCTTTGTCC

GTGATGACAACATCCGACTAACCCCACAG GCCTTCAGCCATTTCACATTTGAGCGTTCTGGTCATCAGCTGATTGTAGTGGACATCCAGGGTGTGGGTG

ACCTTTATACCGACCCACAGATCCACACTGAGAAAGGCACTGACTTTGGAGATGGTAACCTTG GTGTCCGGGGAATGGCTCTCTTCTTCTACTCTCATG

CCTGCAACCGGATTTGTCAGAGCATGGGCCTTACGCCCTTTGACCTCTCCCCACGGGAACAGGATGCGGTGAATCAGAGCACCAGGCTATTG CAATCAG

CCAAGACCATCTTGAGGGGGACAGAGGAGAAGTGTGGGAGTCCCCGCATAAGGACACTCTCTAGCAGCCGGCCCCCTTTGCTCCTTCGCCTGTCAGAGAA

CTCCGGGGATGAGAACATGAGTGACGTGACCTTTGACTCTCTGCCTTCCTCCCCGTCTTCAGCTACACCACACAGCCAGAAACTGGACCACCTCC ATTG

GCCAGTGTTTGGTGACCTCGATAACATGGGCCCTAGAGACCATGACCGCATGGACAATCACCGG GACTCTGAGAATAGTGGGGACAGTGGGTATCCAAG

CGAGAAGCGAAGTGACCTGGATGATCCTGAGCCCCGAGAACAC GGCCACTCCAACGGCAACCGAAGGCATGAATCTGACGAGGATAGCCTGGGCAGCTC

TGGACGG GTCTGTGTGGAGACGTGGAACCTGCTCAATCCCTCCCGCCTGCACCTGCCGAGGCCCTCGGCCGTGGCCCTAGAAGTGCAGAGGCTAAATGC

CCTGGACCTTGGAAGGAAAATCGGGAAGTCTGTTTTGGGGAAG GTCCATTTGGCCATGGTGCGATACCACGAGGGCGGGCGCTTCTGCGAGAAGGATGA

GGAGTGGGATCGAGAGTCAGCCATCTTCCATCTGGAGCATGCAGCTGACCTGGGAGAACTGGAGGCCATCGTGGGCCTAGGCCTCATGTACTCTCAGCTG

CCCCACCACATCCTGGCTGATGTCTCTCTGAAG GAGACAGAGGAGAACAAGACAAAAGGCTTTGATTACTTACTGAAGGCGGCAGAAGCTGGTGACAGG

CATTCCATGATTTTAGTGGCCCGAGCTTTTGACACTGGCCTGAACCTCAGCCCAGACAG GTGTCAAGACTGGTCGGAAGCCTTGCACTGGTACAACACA

GCCCTGGAGACAACAGACTGCGATGAAGGCGGGGAGTACGATGGGATACAGGACGAGCCCCAGTACGCACTGCTGGCCAGGGAGGCGGAGATGCTGCTCA

CCGGGGGATTTGGACTGGACAAGAACCCCCAAAGATCAG - UNI13342 - GAGATTTGTACACCCAGGCAGCTGAGGCAGCAATGGAAGCCATGAAG

GGCCGGCTAGCCAACCAGTACTACGAGAAGGCGGAAGAGGCCTGGGCCCAGATGGAGGAATAACTGCCCCACAGAATCACTGCCAAGGAGAAAGGCTGGG

GAAGGGAGGATGGGACTCATTTCTAGGGAGGGGAGAAGCAGTTTTATTATGGTATAAACTCACTTTTG
Translation
 - UNI25684 - MADEDLIFCLEGVDGGRCSRAGHNADSDTDSDDDEGYFICPITDDHMSNQNVSSKVQSYYSNLTKTECGSTGSPASSFHFK EAWK

HAIEKAKHMPDPWAEFHLEDIATEHATRHR RYNAVTGEWLKDEVLIKMASQ PFGRGAMRECFRT TKKLSNFLHAQQWKGASNYVAKRYIEPVDRSVY

FEDVQLQMEAKLWGEDYNRHKPPKQ VDIMQMCIIELKDRPGQPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQ AFSHFTFERSGHQLIVVDIQGVG

DLYTDPQIHTEKGTDFGDGNLG GVRGMALFFYSHACNRICQSMGLTPFDLSPREQDAVNQSTRLL QSAKTILRGTEEKCGSPRIRTLSSSRPPLLLRL

SENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLH HWPVFGDLDNMGPRDHDRMDNHR DSENSGDSGYPSEKRSDLDDPEPREH GHSNGNRRHESDE

DSLGSSGR VCVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGK VHLAMVRYHEGGRFCEKDEEWDRESAIFHLEHAADLGELEAIVGL

GLMYSQLPHHILADVSLK ETEENKTKGFDYLLKAAEAGDRHSMILVARAFDTGLNLSPDR RCQDWSEALHWYNTALETTDCDEGGEYDGIQDEPQYAL

LAREAEMLLTGGFGLDKNPQRSG - UNI13342 - GDLYTQAAEAAMEAMKGRLANQYYEKAEEAWAQMEE
Transcript ENSMUST00000098076
Sequence
GCCTCCAGCCTCCAGCTCCAACCCCAGCGGCAGCAGCCCCAACTCCAGCCCGTGCTCGGCTCCAGCGCTCCGACGTCTTCAGGCGCCCCACTGCGGCTGC

GGGCCTGGCTCTCTGTCGCCTGCGCTTTGTACCGGGGATTCTCCTCCCTCCCTGCACCCTGGAGCGCCCGGCCGCCAGCCTTTGCCAGCTCCTTGGGATC

CTTGCGGCCGTGGGCAGCAGCTGTCGCGCCTGCCACACTGTGGGAG - UNI25684 - GACCATCCTTGCTGCACGTGCGCAGTAACTCTGGCTGCAC

AGCGGAGCCCCCGGATAACACGGTCGCCCCCGCAACATGGCAGACGAAGACCTCATCTTCTGCCTGGAAGGTGTTGACGGTGGCAGGTGCTCCCGAGCTG

GCCACAATGCGGACTCTGACACAGACAGTGACGATGATGAGGGCTATTTCATCTGCCCCATCACTGATGACCACATGTCCAATCAGAATGTCAGCTCCAA

AGTCCAGAGCTACTATAGCAACCTAACAAAAACAGAGTGCGGCTCCACAGGGTCACCAGCCAGCTCCTTCCACTTCAAG GAAGCCTGGAAGCATGCGAT

CGAGAAAGCCAAGCACATGCCTGACCCCTGGGCTGAATTCCATCTCGAGGACATCGCCACAGAACATGCTACTCGGCACAG GTACAACGCTGTCACCGG

GGAATGGCTGAAAGACGAGGTTCTGATCAAGATGGCGTCTCAG CCCTTCGGCCGTGGAGCAATGAGGGAGTGCTTCAGGAC GAAGAAACTCTCCAACT

TCTTGCACGCCCAGCAATGGAAGGGGGCCTCCAACTACGTGGCCAAGCGCTACATCGAGCCGGTGGACAGGAGCGTGTACTTTGAGGATGTGCAGCTCCA

GATGGAGGCGAAGCTCTGGGGGGAGGATTACAATCGGCACAAGCCCCCCAAGCAG GTGGATATCATGCAGATGTGCATCATTGAGCTAAAGGACAGACC

AGGCCAGCCCCTCTTCCACTTGGAGCACTACATTGAGGGCAAGTACATCAAGTACAATTCCAACTCAGGCTTTGTCCGTGATGACAACATCCGACTAACC

CCACAG GCCTTCAGCCATTTCACATTTGAGCGTTCTGGTCATCAGCTGATTGTAGTGGACATCCAGGGTGTGGGTGACCTTTATACCGACCCACAGATC

CACACTGAGAAAGGCACTGACTTTGGAGATGGTAACCTTG GTGTCCGGGGAATGGCTCTCTTCTTCTACTCTCATGCCTGCAACCGGATTTGTCAGAGC

ATGGGCCTTACGCCCTTT GACCTCGATAACATGGGCCCTAGAGACCATGACCGCATGGACAATCACCGG GACTCTGAGAATAGTGGGGACAGTGGGTA

TCCAAGCGAGAAGCGAAGTGACCTGGATGATCCTGAGCCCCGAGAACAC GGCCACTCCAACGGCAACCGAAGGCATGAATCTGACGAGGATAGCCTGGG

CAGCTCTGGACGG GTCTGTGTGGAGACGTGGAACCTGCTCAATCCCTCCCGCCTGCACCTGCCGAGGCCCTCGGCCGTGGCCCTAGAAGTGCAGAGGCT

AAATGCCCTGGACCTTGGAAGGAAAATCGGGAAGTCTGTTTTGGGGAAG GTCCATTTGGCCATGGTGCGATACCACGAGGGCGGGCGCTTCTGCGAGAA

GGATGAGGAGTGGGATCGAGAGTCAGCCATCTTCCATCTGGAGCATGCAGCTGACCTGGGAGAACTGGAGGCCATCGTGGGCCTAGGCCTCATGTACTCT

CAGCTGCCCCACCACATCCTGGCTGATGTCTCTCTGAAG GAGACAGAGGAGAACAAGACAAAAGGCTTTGATTACTTACTGAAGGCGGCAGAAGCTGGT

GACAGGCATTCCATGATTTTAGTGGCCCGAGCTTTTGACACTGGCCTGAACCTCAGCCCAGACAG GTGTCAAGACTGGTCGGAAGCCTTGCACTGGTAC

AACACAGCCCTGGAGACAACAGACTGCGATGAAGGCGGGGAGTACGATGGGATACAGGACGAGCCCCAGTACGCACTGCTGGCCAGGGAGGCGGAGATGC

TGCTCACCGGGGGATTTGGACTGGACAAGAACCCCCAAAGATCAG AGATGGAGTCTCATGTAGGCCAGTGGACCTCAAACTCACTGTGTAGCTGA
Translation
 - UNI25684 - MADEDLIFCLEGVDGGRCSRAGHNADSDTDSDDDEGYFICPITDDHMSNQNVSSKVQSYYSNLTKTECGSTGSPASSFHFK EAWK

HAIEKAKHMPDPWAEFHLEDIATEHATRHR RYNAVTGEWLKDEVLIKMASQ PFGRGAMRECFRT TKKLSNFLHAQQWKGASNYVAKRYIEPVDRSVY

FEDVQLQMEAKLWGEDYNRHKPPKQ VDIMQMCIIELKDRPGQPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQ AFSHFTFERSGHQLIVVDIQGVG

DLYTDPQIHTEKGTDFGDGNLG GVRGMALFFYSHACNRICQSMGLTPF DLDNMGPRDHDRMDNHR DSENSGDSGYPSEKRSDLDDPEPREH GHSNG

NRRHESDEDSLGSSGR VCVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGK VHLAMVRYHEGGRFCEKDEEWDRESAIFHLEHAADLG

ELEAIVGLGLMYSQLPHHILADVSLK ETEENKTKGFDYLLKAAEAGDRHSMILVARAFDTGLNLSPDR RCQDWSEALHWYNTALETTDCDEGGEYDGI

QDEPQYALLAREAEMLLTGGFGLDKNPQRSE EMESHVGQWTSNSLCS
Transcript ENSMUST00000106487
Sequence
AGAAAGTTACAGGATTCACCGGGCTCCTTCTGAACTTACACAGACAGTGAGCAGGTGCTGGGAAAACAGGCACTGCGGCCAGCAAGGCAGGTCACAAGGT

AGGCAAGGAGATCAGGGTTGCAGCTTTCCTGAGTCCTCAACCGTGCTGGGGCTGGCTTTAGATGATGCAGCTGCTGCTCCT - UNI25684 - GACCA

TCCTTGCTGCACGTGCGCAGTAACTCTGGCTGCACAGCGGAGCCCCCGGATAACACGGTCGCCCCCGCAACATGGCAGACGAAGACCTCATCTTCTGCCT

GGAAGGTGTTGACGGTGGCAGGTGCTCCCGAGCTGGCCACAATGCGGACTCTGACACAGACAGTGACGATGATGAGGGCTATTTCATCTGCCCCATCACT

GATGACCACATGTCCAATCAGAATGTCAGCTCCAAAGTCCAGAGCTACTATAGCAACCTAACAAAAACAGAGTGCGGCTCCACAGGGTCACCAGCCAGCT

CCTTCCACTTCAAG GAAGCCTGGAAGCATGCGATCGAGAAAGCCAAGCACATGCCTGACCCCTGGGCTGAATTCCATCTCGAGGACATCGCCACAGAAC

ATGCTACTCGGCACAG GTACAACGCTGTCACCGGGGAATGGCTGAAAGACGAGGTTCTGATCAAGATGGCGTCTCAG CCCTTCGGCCGTGGAGCAATG

AGGGAGTGCTTCAGGAC GAAGAAACTCTCCAACTTCTTGCACGCCCAGCAATGGAAGGGGGCCTCCAACTACGTGGCCAAGCGCTACATCGAGCCGGTG

GACAGGAGCGTGTACTTTGAGGATGTGCAGCTCCAGATGGAGGCGAAGCTCTGGGGGGAGGATTACAATCGGCACAAGCCCCCCAAGCAG GTGGATATC

ATGCAGATGTGCATCATTGAGCTAAAGGACAGACCAGGCCAGCCCCTCTTCCACTTGGAGCACTACATTGAGGGCAAGTACATCAAGTACAATTCCAACT

CAGGCTTTGTCCGTGATGACAACATCCGACTAACCCCACAG GCCTTCAGCCATTTCACATTTGAGCGTTCTGGTCATCAGCTGATTGTAGTGGACATCC

AGGGTGTGGGTGACCTTTATACCGACCCACAGATCCACACTGAGAAAGGCACTGACTTTGGAGATGGTAACCTTG GTGTCCGGGGAATGGCTCTCTTCT

TCTACTCTCATGCCTGCAACCGGATTTGTCAGAGCATGGGCCTTACGCCCTT TGACCTCGATAACATGGGCCCTAGAGACCATGACCGCATGGACAATC

ACCGG GACTCTGAGAATAGTGGGGACAGTGGGTATCCAAGCGAGAAGCGAAGTGACCTGGATGATCCTGAGCCCCGAGAACAC GGCCACTCCAACGGC

AACCGAAGGCATGAATCTGACGAGGATAGCCTGGGCAGCTCTGGACGG GTCTGTGTGGAGACGTGGAACCTGCTCAATCCCTCCCGCCTGCACCTGCCG

AGGCCCTCGGCCGTGGCCCTAGAAGTGCAGAGGCTAAATGCCCTGGACCTTGGAAGGAAAATCGGGAAGTCTGTTTTGGGGAAG GTCCATTTGGCCATG

GTGCGATACCACGAGGGCGGGCGCTTCTGCGAGAAGGATGAGGAGTGGGATCGAGAGTCAGCCATCTTCCATCTGGAGCATGCAGCTGACCTGGGAGAAC

TGGAGGCCATCGTGGGCCTAGGCCTCATGTACTCTCAGCTGCCCCACCACATCCTGGCTGATGTCTCTCTGAAG GAGACAGAGGAGAACAAGACAAAAG

GCTTTGATTACTTACTGAAGGCGGCAGAAGCTGGTGACAGGCATTCCATGATTTTAGTGGCCCGAGCTTTTGACACTGGCCTGAACCTCAGCCCAGACAG

 GTGTCAAGACTGGTCGGAAGCCTTGCACTGGTACAACACAGCCCTGGAGACAACAGACTGCGATGAAGGCGGGGAGTACGATGGGATACAGGACGAGCC

CCAGTACGCACTGCTGGCCAGGGAGGCGGAGATGCTGCTCACCGGGGGATTTGGACTGGACAAGAACCCCCAAAGATCAG AGATGGAGTCTCATGTAGG

CCAGTGGACCTCAAACTCACTGTGTAGCTGAGAATGACCTTGGATCCTTTTGACTGCTCCTCCCATATGCGTGAGGACCTGAATTTGAATACC
Translation
 - UNI25684 - MADEDLIFCLEGVDGGRCSRAGHNADSDTDSDDDEGYFICPITDDHMSNQNVSSKVQSYYSNLTKTECGSTGSPASSFHFK EAWK

HAIEKAKHMPDPWAEFHLEDIATEHATRHR RYNAVTGEWLKDEVLIKMASQ PFGRGAMRECFRT TKKLSNFLHAQQWKGASNYVAKRYIEPVDRSVY

FEDVQLQMEAKLWGEDYNRHKPPKQ VDIMQMCIIELKDRPGQPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQ AFSHFTFERSGHQLIVVDIQGVG

DLYTDPQIHTEKGTDFGDGNLG GVRGMALFFYSHACNRICQSMGLTPF FDLDNMGPRDHDRMDNHR DSENSGDSGYPSEKRSDLDDPEPREH GHSN

GNRRHESDEDSLGSSGR VCVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGK VHLAMVRYHEGGRFCEKDEEWDRESAIFHLEHAADL

GELEAIVGLGLMYSQLPHHILADVSLK ETEENKTKGFDYLLKAAEAGDRHSMILVARAFDTGLNLSPDR RCQDWSEALHWYNTALETTDCDEGGEYDG

IQDEPQYALLAREAEMLLTGGFGLDKNPQRSE EMESHVGQWTSNSLCS

For any suggestions or comments, please send an email to unitrap@crg.es