Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035095 (Fam167a)
Chromosomal location
Chr 14: 64055231 - 64084335 (+)
Description
family with sequence similarity 167, member A Gene [Source:MGI Symbol;Acc:MGI:3606565]
RefSeq_dna
NM_177628 
RefSeq_peptide
NP_808296.2 
UniGene
Mm.37882 Mm.413218 
MGI
MGI:3606565 
Uniprot/SWISSPROT
Q6P1G6 
Uniprot/SPTREMBL
Q6P9S4 Q8C558 
Human Ortholog
ENSG00000154319 (C8orf13)
Omim not available
UniTrap UNI30510
Vector Insertion
Chr 14: 64071477 - 64081213
Public Clones (ggtc) IST12676C10 (tigm) IST11040D11BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037883
Sequence
ATGGCCTTTCCCAAGGCCAGCTGCCCAGCAAGAGGCGAGTCTGGAGCAGGGAGCATGTGGGGGTGGAGAGCCTTTGATGCCTCTAAAGGAGCCCCGAGAC

CTTCTCCCACCTTCCGCGAGTGCCGGCAG GGTGACAGGCCACTGACCACGGGCAAGCTGGAAGGCTTCCAGAGTATCGATGAAGCTATAGCCTGGCTCA

GAAAGGAACTG - UNI30510 - GCAGAGATGCGGCTCCAGGACCAGCAGCTGGCCAGGCAGCTCATGCGCCTCCGAGGAGACATCAACAAGTTGAAG

ATCGAGCAGACCTGCCGCCTGCACCGGAGGATGCTCAACGATGCCGCCTTTGAGCTGGAGGAGCGGGATGAGCTGTCCGACCTCTTTTGTGACTCCCCGC

TGGCATCCTCTTTCAGCCTTTCCATGCCACTCAAGCTCATTGGCGTCACCAAAATGAACATCAACTCCAGAAGGTTCTCTCTCTGCTGA
Translation
MAFPKASCPARGESGAGSMWGWRAFDASKGAPRPSPTFRECRQ GDRPLTTGKLEGFQSIDEAIAWLRKEL - UNI30510 - AEMRLQDQQLARQLM

RLRGDINKLKIEQTCRLHRRMLNDAAFELEERDELSDLFCDSPLASSFSLSMPLKLIGVTKMNINSRRFSLC
Transcript ENSMUST00000121288
Sequence
GAATGGGAGGCGGGCGGCGGCGCCGAGAGGCTGGCGGCGGACTAGCTCTACGGTCGCCAGGCAACCGCCCTGACGCAACGCAAAAGAACGTCCCTTCAAA

AAAGAACGGTGCGGAGAATTCGCACCGCTACGGAGCCCGGGAGCTCGGGAGGCGGGAGCCGAGCTCCGAGGGAGGGCGGGCGCGGGCTGGCGGCGGGGAC

CGCGACAGCTCCGAGGACGCGCGACTGGAGCTCAAGAAG GTATACAGCTAGAAACATTGGATCCCAAGTGCAGGGGCAGCCATTCACACAGGACACTGC

AAACCAAGCCTTTCTGGGTGAAGGTCCCTGGGAAAATGCAG GCCTACTTTCTGCATTTCCTTTGGCTTTGACCTGTACACCTCCAGCAAGCATAGAGAG

ATCTTGGAGGAGGAGGCTGTCCCAAAGATTTCCTGCTGATGCTTGTCTGATCCTGCCTTCTGTGAAGCATGGCCGCCACAGGATTACGACAGGACAAATC

ATAGACCCTGAGTCTCACAGCTGCTCTGAGAGGCACACGCTACAGCCTTGCTTGGCGCCAGGTGCTGCCACGCCGTGAGACTCACTCCCATCCCAACAAT

GCCTTCAGGCGCCATGGCTGCAGCCGTATGAGACCATTAAGGAGCAGGACTTGACCTTGCTACCCAGTAAACCTCCCGAGCGGCCCCCTACCACCTCCCA

TGTCTGGCTACCAGGGCGGACTAGAGAATGTCTGTGCCCCAGATCCAAGTGGAAGAAGTGAGTGAGAAAGACAGGCCAGCCGGGGCAGCCGTACCTCCTG

ATGACCACCTCCTCAGTCTGAAGGCCCTCACTGAGAAGCTGAGGCTGGAGACCCGAAGACCTTCCTACCTGGAATGGCAGGCCAGGCTGGAAGAGCAGAC

ATGGCCTTTCCCAAGGCCAGCTGCCCAGCAAGAGGCGAGTCTGGAGCAGGGAGCATGTGGGGGTGGAGAGCCTTTGATGCCTCTAAAGGAGCCCCGAGAC

CTTCTCCCACCTTCCGCGAGTGCCGGCAGGGGTGACAGGCCACTGACCACGGGCAAGCTGGAAGGCTTCCAGAGTATCGATGAAGCTATAGCCTGGCTCA

GAAAGGAACTG - UNI30510 - GCAGAGATGCGGCTCCAGGACCAGCAGCTGGCCAGGCAGCTCATGCGCCTCCGAGGAGACATCAACAAGTTGAAG

ATCGAGCAGACCTGCCGCCTGCACCGGAGGATGCTCAACGATGCCGCCTTTGAGCTGGAGGAGCGGGATGAGCTGTCCGACCTCTTTTGTGACTCCCCGC

TGGCATCCTCTTTCAGCCTTTCCATGCCACTCAAGCTCATTGGCGTCACCAAAATGAACATCAACTCCAGAAGGTTCTCTCTCTGCTGAGAAGCCTTAGG

ATGGAAGGGAAACCACAGCCAAGGGTGAGAGAGAGAAGGCTCAGACCAAGTGGTACTTTGGGTACCAGTTACTCCCCCTGAGGTCTTGGGAGTAAAAGGC

ACCAGGACCTGGTGGTAGTATGCCAGGGGCTTCAGCTTTGTATACCTGGGTCTTCATGTTCAAGACCCAAAGAGTCTGCAGACATTATGTAAGGCAGGGC

TCTCAGCAGGATCCCTGTGGCCTTCCCCTCTATGGCCCACTTTCCTGTGACCTAGAATCACTGGTGCTATGATGTTGAATCCCAAAGGGGACACCCCTCC

CATACCCCTGCCAAAGCTTGTTCTTATAGAAAGCTCTACTCTAGGGAAGCTGAGAAGATTAGATTGTGCCAAGTATACCCATCTCTCACGTATTGTTACC

ACCCTCTTAGTGCTAGCTCTAATTGCCCCTATGTAGGAGGCTCAGCAACCTGTGCAGGGATGTGGTAGGACAGGAAAACTTAAAGGAATAACAAGATGAC

AAGTGGGAATGCAGGCTCCTCTTCAATGGCTACCAGCATCCCAGAGAAGGAGCTCTGCCCAGGTACTTTGAACTTCAGCCTTGATGCCACAAGGCCATGC

TGTTTCTAGCTTGATCCATGGCATATGATATATGACATATGTACCTTGTATAGCTTTGGTAGAGCAACCCAGGTATCCTGCTGTCTCCCATTACAACCAC

TTCAGTTACCTCTCTGCCACCCGCAACCCCAGGAGAACACCTAGCAGGCTACTGGTCACTGATGGCTAAACTAGGCAAGATAGGAGATAGATTTCCCACA

AGTGAATTCTATAATAGGGAGCATGACAGAGGTCCCCTGGTGGAACCTGATATTGTCACCTTATCCTCCGTACCAAAGACCCCAGGGATCCCAAAATTCC

ATCCTGAGCCTCTCCCAAGACTGTGCCTGATCTAAGCAATGGATTTCAATTGACCATGACTGTTAACTAATGCGTTGCTAACTTGTTAATACCTGTCTGA

ATCCTGTCCAAATGGAAAACCAGTTGAGTAGGCCACACAGAGTTTGGGCTTTAGTTTTGAGAGTTTTTCCCTAGCAGCAAGCTTGAGCTCAGTAAAATGT

TAAGCTCTTCAGTTCAGGGAAGACCTGGTACGGCACACCTGGCCACAATCCTCTTAACACAAGTTCCTCATACTCTGGGTGTGTCTAGTGAGGTCTGCTC

GACTCTGGGTGTGTCTAGTGAGGTCTGCTCATGAGCACAGAAGGGCAGAGTGAAGCCTGGAAAGACAATGACTTCCCTCCAGTTACCTGGCTGCTCCACA

GCTATAGAATATTAAGGTGTGAAATTACTGTGAATCCAGCCTAGATCTTCTGCCAATGAACTTGAACTCCAAAAGATGGTACTGATGCTCTGCCAAACCC

ACAAGTTGCCAGCTTCTCCCTCCCTCCCTCCCTCTCGGTCCCTATTCATTCTTCTCTGGCAATGACTAGTACTGGGGTTGGGGAGAGGGGAGCATAACTC

CCAGATGGCGGACCCTTAGCACTTACCACTTGTCAGGGCTCTGCGGTCTATACTGACTGTTCTCTGTATATAACATTTCTTCCTACCGATAATCCCCATG

AGCTGTGTCCACACACGACACAACACACGCAGACTGGAATGGAAAGATAATACTGAATGGCCTCTTCCTTGTGATTTCAAAGAGCCAAACTGTTTTTGTT

TCTTTTTTTAAAGATAGAACAAGGTAGCCAAGATTTTTTTAAGAGCCCTGAAGTCCAGAGGCCTTGACCCCAGTCCCTTCCTTCAAGACTACACAAAACA

CTGCCAAGTCCCAAGAGGCCTTTATTTCCCATCACCTCCTGCCTCTGGTCACCCCCGACCCTTGGGTGACACTCGCCACATCACAGAGAGCACATGAAAG

AAGGACCATCCTGTATTCTAAAAACAATGCCAAACTGAGCGTAAGAAATTAAATCATTATCCAGGCATGGTAGTGCACGTCTTTAATCCCAGCACTCAGG

AGGTGGAGGGAGGAAGATCAGGAGTTCAAGACTAGCCTATGATACCTAGTAAGTTCTCCAAGTCAGCCTGGGCTTTATGAGACCACACCTCATAAACATA

ACAGTCACCAGTTATTACAGTAACTGACGCTCTTAGCTTAAAGCAAAGCAGAGTGATCGACTTGGATATGGTCAGCAACTAACTATGTGACTGAGCAGTC

TGTGCTCAGATAGGAAAGCACCCAGCATCTTCCTCCTGCTTTTGTTCTCTGGGAAAACTTTGTCCTAGGCAGGGTTTGAATAGATTAGATGTTTCAACTT

AAGTTGTTCATCCCAAGAGAATTGTATTCTGGGATAAGGATGGGGGGCTGGGGAGTAGACTGAAAAGGTGGAAGGGAAAGTCATTCTGTCATCTTACCTG

TAGTCTAGTGTCTGTTAGCTCTCTGCCTTCCGTGGTGAGCTCAAACCATTAACTGTTCACTCTGGTGGTAGAATCCCCGCAGAGATGTCTGTAGGTCTGT

GGCAACATTAGCTGCCTTCCTCAGCCAGCGTCCTGCCTTACTGTATGTTCACTGTCCTGTTTGGTGTTCCCTCCTTAACCATCTCTATCCCCCCCCCCAG

GTGAGACATGAACTATCCACTGTGCTGCCACAAGGTCATGTCCAATGCCTCCATGGCCTCAGTAGCAATCACAGAGGCTTAGAGGGCCTGGACAGGCCTG

GCCATAACCTGGCCTCATCTAAGACCTACCCCTGTAGCAATACCAAGTGCTATTACATAATCAATTGACAATTTACAGTTTTATTTTTATGATTATTTGT

TTCTATATTACTGTTAGAAAAAGTGAAATAAAAATATTTCAAAAGGA
Translation
  MSVPQIQVEEVSEKDRPAGAAVPPDDHLLSLKALTEKLRLETRRPSYLEWQARLEEQTWPFPRPAAQQEASLEQGACGGGEPLMPLKEPRDLLPPSAS

AGRGDRPLTTGKLEGFQSIDEAIAWLRKEL - UNI30510 - AEMRLQDQQLARQLMRLRGDINKLKIEQTCRLHRRMLNDAAFELEERDELSDLFCD

SPLASSFSLSMPLKLIGVTKMNINSRRFSLC
Transcript ENSMUST00000089351
Sequence
CAACCGCCCTGACGCAACGCAAAAGAACGTCCCTTCAAAAAAGAACGGTGCGGAGAATTCGCACCGCTACGGAGCCCGGGAGCTCGGGAGGCGGGAGCCG

AGCTCCGAGGGAGGGCGGGCGCGGGCTGGCGGCGGGGACCGCGACAGCTCCGAGGACGCGCGACTGGAGCTCAAGAAG GTATACAGCTAGAAACATTGG

ATCCCAA AGATTTCCTGCTGATGCTTGTCTGATCCTGCCTTCTGTGAAGCATGGCCGCCACAGGATTACGACAGGACAAATCATAGACCCTGAGTCTCA

CAGCTGCTCTGAGAGGCACACGCTACAGCCTTGCTTGGCGCCAGGTGCTGCCACGCCGTGAGACTCACTCCCATCCCAACAATGCCTTCAGGCGCCATGG

CTGCAGCCGTATGAGACCATTAAGGAGCAGGACTTGACCTTGCTACCCAGTAAACCTCCCGAGCGGCCCCCTACCACCTCCCATGTCTGGCTACCAGGGC

GGACTAGAGAATGTCTGTGCCCCAGATCCAAGTGGAAGAAGTGAGTGAGAAAGACAGGCCAGCCGGGGCAGCCGTACCTCCTGATGACCACCTCCTCAGT

CTGAAGGCCCTCACTGAGAAGCTGAGGCTGGAGACCCGAAGACCTTCCTACCTGGAATGGCAGGCCAGGCTGGAAGAGCAGACATGGCCTTTCCCAAGGC

CAGCTGCCCAGCAAGAGGCGAGTCTGGAGCAGGGAGCATGTGGGGGTGGAGAGCCTTTGATGCCTCTAAAGGAGCCCCGAGACCTTCTCCCACCTTCCGC

GAGTGCCGGCAGGGGTGACAGGCCACTGACCACGGGCAAGCTGGAAGGCTTCCAGAGTATCGATGAAGCTATAGCCTGGCTCAGAAAGGAACTG - UNI

30510 - GCAGAGATGCGGCTCCAGGACCAGCAGCTGGCCAGGCAGCTCATGCGCCTCCGAGGAGACATCAACAAGTTGAAGATCGAGCAGACCTGCCG

CCTGCACCGGAGGATGCTCAACGATGCCGCCTTTGAGCTGGAGGAGCGGGATGAGCTGTCCGACCTCTTTTGTGACTCCCCGCTGGCATCCTCTTTCAGC

CTTTCCATGCCACTCAAGCTCATTGGCGTCACCAAAATGAACATCAACTCCAGAAGGTTCTCTCTCTGCTGAGAAGCCTTAGGATGGAAGGGAAACCACA

GCCAAGGGTGAGAGAGAGAAGGCTCAGACCAAGTGGTACTTTGGGTACCAGTTACTCCCCCTGAGGTCTTGGGAGTAAAAGGCACCAGGACCTGGTGGTA

GTATGCCAGGGGCTTCAGCTTTGTATACCTGGGTCTTCATGTTCAAGACCCAAAGAGTCTGCAGACATTATGTAAGGCAGGGCTCTCAGCAGGATCCCTG

TGGCCTTCCCCTCTATGGCCCACTTTCCTGTGACCTAGAATCACTGGTGCTATGATGTTGAATCCCAAAGGGGACACCCCTCCCATACCCCTGCCAAAGC

TTGTTCTTATAGAAAGCTCTACTCTAGGGAAGCTGAGAAGATTAGATTGTGCCAAGTATACCCATCTCTCACGTATTGTTACCACCCTCTTAGTGCTAGC

TCTAATTGCCCCTATGTAGGAGGCTCAGCAACCTGTGCAGGGATGTGGTAGGACAGGAAAACTTAAAGGAATAACAAGATGACAAGTGGGAATGCAGGCT

CCTCTTCAATGGCTACCAGCATCCCAGAGAAGGAGCTCTGCCCAGGTACTTTGAACTTCAGCCTTGATGCCACAAGGCCATGCTGTTTCTAGCTTGATCC

ATGGCATATGATATATGACATATGTACCTTGTATAGCTTTGGTAGAGCAACCCAGGTATCCTGCTGTCTCCCATTACAACCACTTCAGTTACCTCTCTGC

CACCCGCAACCCCAGGAGAACACCTAGCAGGCTACTGGTCACTGATGGCTAAACTAGGCAAGATAGGAGATAGATTTCCCACAAGTGAATTCTATAATAG

GGAGCATGACAGAGGTCCCCTGGTGGAACCTGATATTGTCACCTTATCCTCCGTACCAAAGACCCCAGGGATCCCAAAATTCCATCCTGAGCCTCTCCCA

AGACTGTGCCTGATCTAAGCAATGGATTTCAATTGACCATGACTGTTAACTAATGCGTTGCTAACTTGTTAATACCTGTCTGAATCCTGTCCAAATGGAA

AACCAGTTGAGTAGGCCACACAGAGTTTGGGCTTTAGTTTTGAGAGTTTTTCCCTAGCAGCAAGCTTGAGCTCAGTAAAATGTTAAGCTCTTCAGTTCAG

GGAAGACCTGGTACGGCACACCTGGCCACAATCCTCTTAACACAAGTTCCTCATACTCTGGGTGTGTCTAGTGAGGTCTGCTCGACTCTGGGTGTGTCTA

GTGAGGTCTGCTCATGAGCACAGAAGGGCAGAGTGAAGCCTGGAAAGACAATGACTTCCCTCCAGTTACCTGGCTGCTCCACAGCTATAGAATATTAAGG

TGTGAAATTACTGTGAATCCAGCCTAGATCTTCTGCCAATGAACTTGAACTCCAAAAGATGGTACTGATGCTCTGCCAAACCCACAAGTTGCCAGCTTCT

CCCTCCCTCCCTCCCTCTCGGTCCCTATTCATTCTTCTCTGGCAATGACTAGTACTGGGGTTGGGGAGAGGGGAGCATAACTCCCAGATGGCGGACCCTT

AGCACTTACCACTTGTCAGGGCTCTGCGGTCTATACTGACTGTTCTCTGTATATAACATTTCTTCCTACCGATAATCCCCATGAGCTGTGTCCACACACG

ACACAACACACGCAGACTGGAATGGAAAGATAATACTGAATGGCCTCTTCCTTGTGATTTCAAAGAGCCAAACTGTTTTTGTTTCTTTTTTTAAAGATAG

AACAAGGTAGCCAAGATTTTTTTAAGAGCCCTGAAGTCCAGAGGCCTTGACCCCAGTCCCTTCCTTCAAGACTACACAAAACACTGCCAAGTCCCAAGAG

GCCTTTATTTCCCATCACCTCCTGCCTCTGGTCACCCCCGACCCTTGGGTGACACTCGCCACATCACAGAGAGCACATGAAAGAAGGACCATCCTGTATT

CTAAAAACAATGCCAAACTGAGCGTAAGAAATTAAATCATTATCCAGGCATGGTAGTGCACGTCTTTAATCCCAGCACTCAGGAGGTGGAGGGAGGAAGA

TCAGGAGTTCAAGACTAGCCTATGATACCTAGTAAGTTCTCCAAGTCAGCCTGGGCTTTATGAGACCACACCTCATAAACATAACAGTCACCAGTTATTA

CAGTAACTGACGCTCTTAGCTTAAAGCAAAGCAGAGTGATCGACTTGGATATGGTCAGCAACTAACTATGTGACTGAGCAGTCTGTGCTCAGATAGGAAA

GCACCCAGCATCTTCCTCCTGCTTTTGTTCTCTGGGAAAACTTTGTCCTAGGCAGGGTTTGAATAGATTAGATGTTTCAACTTAAGTTGTTCATCCCAAG

AGAATTGTATTCTGGGATAAGGATGGGGGGCTGGGGAGTAGACTGAAAAGGTGGAAGGGAAAGTCATTCTGTCATCTTACCTGTAGTCTAGTGTCTGTTA

GCTCTCTGCCTTCCGTGGTGAGCTCAAACCATTAACTGTTCACTCTGGTGGTAGAATCCCCGCAGAGATGTCTGTAGGTCTGTGGCAACATTAGCTGCCT

TCCTCAGCCAGCGTCCTGCCTTACTGTATGTTCACTGTCCTGTTTGGTGTTCCCTCCTTAACCATCTCTATCCCCCCCCCCAGGTGAGACATGAACTATC

CACTGTGCTGCCACAAGGTCATGTCCAATGCCTCCATGGCCTCAGTAGCAATCACAGAGGCTTAGAGGGCCTGGACAGGCCTGGCCATAACCTGGCCTCA

TCTAAGACCTACCCCTGTAGCAATACCAAGTGCTATTACATAATCAATTGACAATTTACAGTTTTATTTTTATGATTATTTGTTTCTATATTACTGTTAG

AAAAAGTGAAATAAAAATATTTCAAAAGG
Translation
  MSVPQIQVEEVSEKDRPAGAAVPPDDHLLSLKALTEKLRLETRRPSYLEWQARLEEQTWPFPRPAAQQEASLEQGACGGGEPLMPLKEPRDLLPPSAS

AGRGDRPLTTGKLEGFQSIDEAIAWLRKEL - UNI30510 - AEMRLQDQQLARQLMRLRGDINKLKIEQTCRLHRRMLNDAAFELEERDELSDLFCD

SPLASSFSLSMPLKLIGVTKMNINSRRFSLC

For any suggestions or comments, please send an email to unitrap@crg.es