Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035131 (B830045N13Rik)
Chromosomal location
Chr 1: 148342796 - 148749599 (+)
Description
RIKEN cDNA B830045N13 gene Gene [Source:MGI Symbol;Acc:MGI:2443035]
RefSeq_dna
NM_153539 
RefSeq_peptide
NP_705767.2 
UniGene
Mm.441817 
MGI
MGI:2443035 
Uniprot/SWISSPROT
Q499E0 
Uniprot/SPTREMBL
Q3USC1 B1AQR9 B1AQT5 
Human Ortholog
ENSG00000162670 (FAM5C)
Omim not available
UniTrap UNI31963
Vector Insertion
Chr 1: 148362246 - 148529705
Public Clones IST13298E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111931
Sequence
TAGGTAAGTGCGTTTTGCTGTGTTAGAACCAGGAGCTCTGCCTTCTGTGAGGGAAATTGACAGGAGAGACAGGCTCTTGCAGCCAAGAATGCTTTAACCA

GAGGGCTAGCAACAG GTCCAGAACGTGATCAGTTCTCCAGCAGAGCAGGGACCTCCTTGTAAAGGGAGCCTTGGTGTGGAGATTCAGG GTGTTGAGGG

AAAGCTGAGAGGATGACGGCTCTAAGTCCCCAGTGGAAGCATGATATGGCGGCGCAGAGCTGGTGCTGAACTGTCCTCTCTGATGGCTCTATGGGAGTGG

ATAGTACTGAGTCTTCATTGCTGGGTTTTAGCGGTTGCTGCTGTCTCTGACCAGCATGCCACAAGCCCCTTCGACTGGCTCCTCTCTGATAAGGGACCCT

TCCATCGCTCACAGGAGTACACAGATTTTGTGGACAGAAGCCGACAGGGATTTAGCACAAGATACAAGATATACAGGTATGAAAGAAAGACAATGACAAG

TAGCATATTTGTAGGTCGTGTGTCAATAAGGGCTGCTCCAATGAAAAGTAGCAGAAGGGTTATCATTACTTTTAAAAACTTTTATTAGTCTTCAGCCTAA

ACGGGAATAAATAACTTGTAATTAATTAGTCACTGAGA
Translation
  MALWEWIVLSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQGFSTRYKIYRYERKTMTSSIFVGRVSIRAAPMKSSRRVIITFK

NFY
Transcript ENSMUST00000074622
Sequence
CACTAGTTGTCTACTCCTGTTTACAACACATCCTTTCACTTCTCTTTGGAGATCTGTTTGTCTTATTCATCCTGTTCTCTTGGGTTACCCAGCTTCCTCA

CTTTGTGGGTACTTCCAGTTTGGTACATTTGTTTGCCTGAGGATTATCATAAGAAAGGTTCCCACTGTTAACCATTCTCAGAAAAGAAAAAAAAAAGAAA

GAAAGAAAGCACTTCTTTAACATTTTTGGGTTCTTGGCCCCTGGAATAAGTGACTTTCACCTGATTAGATGCCACCAGGAACTACTGAGTGTTTCCAACT

CCTACTTTCCTGCAGCTCACCACTCTACACTGCTTTGGAAGATCATGGGATGTCTCCTTGAATCGTGGATATGTTTCTCTCACACTCATCTTGCTTCATT

AACTTTCCTCTG GTGTTGAGGGAAAGCTGAGAGGATGACGGCTCTAAGTCCCCAGTGGAAGCATGATATGGCGGCGCAGAGCTGGTGCTGAACTGTCCT

CTCTGATGGCTCTATGGGAGTGGATAGTACTGAGTCTTCATTGCTGGGTTTTAGCGGTTGCTGCTGTCTCTGACCAGCATGCCACAAGCCCCTTCGACTG

GCTCCTCTCTGATAAGGGACCCTTCCATCGCTCACAGGAGTACACAGATTTTGTGGACAGAAGCCGACAGGGATTTAGCACAAGATACAAGATATACAG 

- UNI31963 - GGAGTTTGGTCGTTGGAAGGTAAATAACCTTGCAGTTGAGAGAAGAAATTTCCTTGGTTCTCCTCTGCCTCTTGCCCCTGAGTTCTT

CCGCAACATAAGACTTTTGGGACGACGACCTACTCTACAGCAAATCACAGAAAATCTTATCAAGAAATATGGGACTCATTTCTTGCTATCAGCTACTCTG

GGAG GAGAGGAGTCACTCACAATTTTTGTGGACAAGCGGAAGCTGAGCAAAAGATCTGAAGGAAGTGAAACCAGCACCAATAGTTCGTCTGTTACCCTG

GAGACCTTACATCAATTGGCTGCTTCCTATTTTATTGACAGGGACAGCACCCTTCGCAGACTTCACCATATCCAAATTGCATCCACTGCCATCAAG GTG

ACAGAAACACGGACAGGTCCTCTTGGCTGCAGTAACTATGACAACCTAGATTCTGTCAGCTCTGTTCTGGTTCAGAGTCCTGAGAATAAAATTCAGTTGC

AAG GGCTTCAAGTTCTCCTTCCCGACTACCTTCAGGAACGTTTTGTACAGGCAGCACTGAGCTACATTGCTTGCAATTCTGAGGGCGAGTTTATCTGCA

AGGATAATGACTGCTGGTGCCACTGTGGTCCAAAATTCCCAGAATGTAATTGCCCTTCCATGGATATTCAAGCCATGGAAGAGAATCTTCTTCGAATAAC

AGAAACATGGAAAGCCTACAACAGTGACTTTGAAGATTCAG ATGAATTCAAGTTCTTTATGAAAAGACTACCCATGAATTATTTTCTCAACACTTCAAC

TATAATGCATTTGTGGACAATGGATTCTAATTTTCAGCGCCGCTACGAACAACTGGAGAACAGCATGAAACAGCTTTTCCTGAAGGCACACAGAATTGTA

CACAAGCTCTTTAGCCTTAGCAAACGGTGCCACAAGCAGCCTCTCATCAGCCTGCCGAGACAGAG AACATCAACCTACTGGCTCACTCGCATCCAGTCT

TTTCTCTACTGCAATGAGAATGGCCTTCTGGGAAGCTTCTCCGAGGAAACCCACTCCTGCACATGCCCCAACGACCAGGTAGTGTGCACAGCCTTTCTGC

CCTGTACTGTGGGCGATGCCTCTGCCTGCCTTACCTGTGCACCTGACAACCGTACCCGGTGTGGCACCTGCAACACAGGCTACATGCTGAGCCAGGGACT

CTGCAAGCCTGAAGTCGCTGAGTCAACCGATCACTACATTGGCTTTGAGACCGACCTACAAGACCTAGAGATGAAATACCTGTTGCAGAAAACAGATAGA

CGAATAGAAGTACATGCCATCTTTATCAGCAATGACATGCGCCTCAACAGCTGGTTTGATCCTTCCTGGAGAAAGCGGATGCTCCTGACCTTGAAGAGTA

ACAAATACAAGTCCAGTCTGGTCCACATGATCTTGGGTCTCTCTTTACAGATTTGCTTAACTAAAAACAGCACGTTGGAGCCAGTGCTGGCTGTTTATGT

CAATCCCTTTGGAGGCAGCCACTCCGAGAGCTGGTTTATGCCTGTGAGTGAGAGCAGCTTTCCAGACTGGGAGCGGACTAAGCTGGACCTCCCTCTACAG

TGCTATAACTGGACACTGACTCTGGGAAACAAATGGAAGACATTTTTTGAGACAGTACACATCTACCTGAGGAGTCGCATCAAGGCAAATGGCCCCAACA

GCAATGAGAGCATTTATTATGAGCCTTTGGAGTTTATTGACCCATCCCGGAACCTGGGCTACATGAAAATCAACAACATCCAAGTGTTTGGCTACAGCAT

GCACTTTGACCCTGAAGCCATTCGGGACCTGATTTTGCAGCTGGACTACCCTTATACTCAGGGATCCCAGGACTCGGCACTTTTGCAGCTACTAGAGATA

AGAGACCGTGTAAATAAACTCTCCCCACCCGGTCAGCGCCGCCTGGATCTGTTTTCTTGCTTGCTTCGTCATAGACTCAAGCTGTCTACTAGTGAGGTGG

TGAGAATTCAGTCTGCTCTTCAGGCATTTAATGCCAAGTTGCCAAACACAGTGGATTATGACACAACCAAATTATGTAGTTAACCATAAATGTCAAGCAC

AACCCAAAATCTTGAAGGAGTTTTTACAGTGCTTTTGTGGAAGTTTATGTTTGGAAAAGTAAATTTAAATTGTCTTTTCAATATCTGTCTTATATCAGTC

AATAACGTTGGATGGCAATTTACACACATGAACTTGCTGACAATGAATATATTATACTACAGTTTTGGTTTATGAATGAAATAAATACTGACACCAGTCT

AGAAGACATTCTACTTTTTACAATAAATTTCATTTGTAATTTTATATGTTCCGTGGCAATGCTTTTGTGCATTACATCCTCTAGAGGGAACATAAAAAGA

TACCAATAAAATTTTGTAGCTGAACAGTTATTAAC
Translation
 MIWRRRAGAELSSLMALWEWIVLSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEYTDFVDRSRQGFSTRYKIYR - UNI31963 - REFGRW

KVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTLQQITENLIKKYGTHFLLSATLGG GEESLTIFVDKRKLSKRSEGSETSTNSSSVTLETLHQLAA

SYFIDRDSTLRRLHHIQIASTAIK VTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQLQG GLQVLLPDYLQERFVQAALSYIACNSEGEFICKDNDCW

CHCGPKFPECNCPSMDIQAMEENLLRITETWKAYNSDFEDSD DEFKFFMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLENSMKQLFLKAHRIVHKLF

SLSKRCHKQPLISLPRQR RTSTYWLTRIQSFLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCK

PEVAESTDHYIGFETDLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSNKYKSSLVHMILGLSLQICLTKNSTLEPVLAVYVNP

FGGSHSESWFMPVSESSFPDWERTKLDLPLQCYNWTLTLGNKWKTFFETVHIYLRSRIKANGPNSNESIYYEPLEFIDPSRNLGYMKINNIQVFGYSMHF

DPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRRLDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTVDYDTTKLCS

For any suggestions or comments, please send an email to unitrap@crg.es