Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035168 (Tanc1)
Chromosomal location
Chr 2: 59450099 - 59684206 (+)
Description
tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1 Gene [Source:MGI (curated);Acc:Tanc1-001]
RefSeq_dna
NM_198294 
RefSeq_peptide
NP_938036.2 
UniGene
Mm.27917 Mm.471959 
MGI
MGI:1914110 
Uniprot/SWISSPROT
Q0VGY8 
Uniprot/SPTREMBL
A2AUL5 A2AUL7 Q8CHA0 Q80YQ9 
Human Ortholog
ENSG00000115183 (TANC1)
Omim not available
UniTrap UNI8198
Vector Insertion
Chr 2: 59450254 - 59484825
Public Clones (sanger) RRH327 (baygenomics) E080G02 (ggtc) E019G11 (ggtc) D180E05 (ggtc)
D145E07 (ggtc) D093D02 (ggtc) 3SE171H09 (ggtc) P144F10 (ggtc) E049G04 (ggtc)
D186G04 (ggtc) D168G05 (ggtc) D124F02 (ggtc) D051E11 (ggtc) P065G01 (ggtc)
E119G02 (ggtc) E022G08 (ggtc) D186E03 (ggtc) D153G11 (ggtc) D097D03 (ggtc)
D031F03 (ggtc) P147E01 (ggtc) E062H10 (ggtc) D062A10 (ggtc) 5SE307B07 (ggtc)
M123D04 (ggtc) E043G07 (ggtc) D124C07 (ggtc) D051C08 (ggtc) P016G03 (ggtc)
D186B02 (ggtc) D150B11 (ggtc) 5SE171H09 (ggtc) E052B11 (ggtc) D186H03 (ggtc)
D175D05 (ggtc) D135E11 (ggtc) E130D09 (ggtc) E041G09 (ggtc) D186F03 (ggtc)
D160H10 (ggtc) FHCRC-GT-S8-8D1 (fhcrc) IST10900B3 (tigm) IST14425B10 (tigm)
IST14384B10 (tigm) IST15036E1 (tigm) IST11847E5 (tigm) IST14974B7 (tigm)
IST14543D1 (tigm) IST13105F5 (tigm) IST14070G10 (tigm) IST12479G4 (tigm)
IST14584D1 (tigm) IST13244E12 (tigm) IST12839G1 (tigm) IST14395H8 (tigm)
IST14459B6 (tigm) IST14269H3 (tigm) IST14190F5 (tigm) IST10897A1 (tigm)
IST11260H11 (tigm) IST15014A11 (tigm) IST14526C8 (tigm) IST14115C7 (tigm)
IST10151E1 (tigm) IST14224G11 (tigm) IST14426G7 (tigm) IST12694H12 (tigm)
IST14459H6 (tigm) IST14700B5 (tigm) IST11844C4 (tigm) IST10782D11 (tigm)
IST14318D5 (tigm) IST15003H5 (tigm) IST14273A4 (tigm) IST10691H8 (tigm)
IST10731E9 (tigm)
Private Clones OST198946 (lexicon) OST40200 (lexicon) OST37500 (lexicon) OST37498 (lexicon)
OST32739 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17236
Vector Insertion
Chr 2: 59484930 - 59537404
Public Clones (sanger) E066D03 (ggtc) D056F01 (ggtc) E019F01 (ggtc) E079C03 (ggtc)
D068F10 (ggtc) E039D02 (ggtc) D017B07 (ggtc) D174D04 (ggtc) P134H10 (ggtc)
D114G06 (ggtc) CMHD-GT_504B5-3 (cmhd) IST14719E10 (tigm) IST12389D9 (tigm)
IST11012C10 (tigm) IST14547C5 (tigm) IST14639D5 (tigm) IST10872E6 (tigm)
IST13682A3 (tigm) IST14755G9 (tigm) IST14648H5 (tigm) IST12443B7 (tigm)
IST14688B5 (tigm) IST14676D2 (tigm) IST14231C7 (tigm)
Private Clones OST447090 (lexicon) OST443202 (lexicon) OST434645 (lexicon) OST391078 (lexicon)
OST376359 (lexicon) OST369521 (lexicon) OST352468 (lexicon) OST339747 (lexicon)
OST307401 (lexicon) OST289089 (lexicon) OST288887 (lexicon) OST268892 (lexicon)
OST267896 (lexicon) OST261871 (lexicon) OST260841 (lexicon) OST259294 (lexicon)
OST252515 (lexicon) OST247986 (lexicon) OST246491 (lexicon) OST236334 (lexicon)
OST236253 (lexicon) OST233163 (lexicon) OST208781 (lexicon) OST208398 (lexicon)
OST204086 (lexicon) OST199061 (lexicon) OST190999 (lexicon) OST185998 (lexicon)
OST184188 (lexicon) OST183959 (lexicon) OST181643 (lexicon) OST178227 (lexicon)
OST169633 (lexicon) OST133883 (lexicon) OST118818 (lexicon) OST115488 (lexicon)
OST112450 (lexicon) OST50958 (lexicon) OST43575 (lexicon) OST42700 (lexicon)
OST35385 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1525
Vector Insertion
Chr 2: 59484930 - 59537404
Public Clones CC0567 (sanger) P015F07 (ggtc) FHCRC-GT-S14-8G1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13559
Vector Insertion
Chr 2: 59537404 - 59537485
Public Clones CMHD-GT_306B3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29755
Vector Insertion
Chr 2: 59537485 - 59562717
Public Clones (sanger) E044D07 (ggtc) D151B04 (ggtc) E078G09 (ggtc) E082B03 (ggtc)
IST10835H10 (tigm) IST14773A7 (tigm) IST12283E6 (tigm) IST11536A3 (tigm)
IST14738F3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6463
Vector Insertion
Chr 2: 59537485 - 59562717
Public Clones LRY041 (baygenomics) Q014A02 (ggtc) P026D03 (ggtc) A015B04 (ggtc)
P026C04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27382
Vector Insertion
Chr 2: 59562717 - 59562907
Public Clones not available
Private Clones OST61056 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI170
Vector Insertion
Chr 2: 59562907 - 59580858
Public Clones GC0168 (tigem) CSI072 (baygenomics) A060F02 (ggtc) IST11648B11 (tigm)
IST11695F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29633
Vector Insertion
Chr 2: 59580990 - 59596521
Public Clones (sanger) D102H09 (ggtc) E132C03 (ggtc) IST10029C3 (tigm) IST10991B8 (tigm)
IST14100C7 (tigm) IST11584F2 (tigm) IST14011H8 (tigm) IST14282D6 (tigm)
IST14433D6 (tigm) IST14362C3 (tigm) IST13431H12 (tigm) IST12482B7 (tigm)
IST12949E2 (tigm) IST10753H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21183
Vector Insertion
Chr 2: 59596521 - 59596627
Public Clones not available
Private Clones OST339307 (lexicon) OST299881 (lexicon) OST233996 (lexicon) OST145756 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI680
Vector Insertion
Chr 2: 59596521 - 59596627
Public Clones DC0325 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5444
Vector Insertion
Chr 2: 59609188 - 59609320
Public Clones XD077 (baygenomics) CSJ144 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9951
Vector Insertion
Chr 2: 59609320 - 59610409
Public Clones XC358 (baygenomics) IST12352C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI402
Vector Insertion
Chr 2: 59610597 - 59623380
Public Clones GC1441 (tigem) XG853 (baygenomics) YTA466 (baygenomics) XC786 (baygenomics)
YTA107 (baygenomics) (ggtc) A012C02 (ggtc) IST12284C1 (tigm) IST12850H10 (tigm)
Private Clones OST307616 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11871
Vector Insertion
Chr 2: 59623380 - 59623645
Public Clones A068E02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28222
Vector Insertion
Chr 2: 59635810 - 59637627
Public Clones not available
Private Clones OST36655 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1206
Vector Insertion
Chr 2: 59653612 - 59655541
Public Clones CE0101 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5713
Vector Insertion
Chr 2: 59655728 - 59658263
Public Clones CSI044 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9955
Vector Insertion
Chr 2: 59659439 - 59671192
Public Clones XE017 (baygenomics) IST10257B12 (tigm) IST14744G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11853
Vector Insertion
Chr 2: 59671327 - 59672637
Public Clones A071B01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9883
Vector Insertion
Chr 2: 59675276 - 59677031
Public Clones RST120 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10164
Vector Insertion
Chr 2: 59677124 - 59678995
Public Clones XB732 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037526
Sequence
GGACGGGCCGGAGCGCTGCCTCCGCGGTGGCAGCTGCGGGAGCCCGGCTCGGGAGCCGCAGGAGCCGCAGCCGCCAAGCGCCCAGCCCTCTGCGCCCTGA

GGCTCGGCCCCCGGGGTGGGAACCGCGCCGAAAGCTGGAAACTTTCCTGGCAG - UNI8198 - GAGCTGACTGTTGGGCACAGAGGAAGGACAGGAG

AGAGAGCTGAGACATAAGGACCACTGTACCGCGTTTCTTCCTTCCATGAATGAGAAGATACCAGAGATAG - UNI1525 - - UNI13559 - - UN

I17236 - AGACAAAAGACTGTTGAAAATGCTGAAGGCTGTGCTGAAGAAGAGCCGAGAGGGAGGAAAGGGAAGCAAGAAGGAAGCAG - UNI6463 

- - UNI13559 - - UNI27382 - - UNI29755 - GAGGTGACTTTGGCTCAGAGACGCCTGCCTTGTCCTCCAGTGGTGACTCTCCTGTGAAC

AGTTTGTCCACAACAGAGGACACTTATCGTGTGAGCTTGGCCAAAGGGGTCTCTATGTCTCTTCCTTCATCACCTTTGCTGCCTCGACAATCTCTCCTGA

CACAGTCAAGATCGAACAAAAAATCTCCAG - UNI170 - - UNI680 - - UNI21183 - - UNI27382 - - UNI29633 - GTCCCGTC

AGGAAGCCCAAGTATGTGGAAAGCCCCAGGGTGCCGGGAGATCCAGTTATGATCCCGTTCGGAGAAGGGTCCAAGCCCTCAGAGCCCAGTGCGACTG - 

UNI680 - - UNI5444 - - UNI21183 - AAGCGAAGGCTGATAATGAACCGAGCTGCTCTCCAGCAGCTCAAGAACTGTTGACAAGGCTGGGAT

TTCTACTGGGAGAGGGGATCCCGAGCGCCACACACATAACCATTGAAGACAAAAATGAAGCCATG - UNI5444 - - UNI9951 - TGCACAGCCC

TGAGTCAAGGCATCAGCCCTTGTTCCACACTCACAAGCAGCACTGCCTCTCCCAGCACCGACAGCCCCTGCTCGACCTTGAATAGCTGTGTCAGCAAGAC

GGCAGCCAGCAAAAGTCCCTGCGAGACCATTAGCAGCCCCAGTTCCACCCTGGAAAGCAAGGACAGTGGAATTATAG - UNI402 - - UNI11871 

- CCACAATCACAAGTTCATCGGAAAATGATGACCGGAGTGGCTCCAGTCTGGAATGGAACAGAGACGGAAGCCTAAGGTTAGGGGTTCAGAAGGGAGTG

CTTCATGACCGAAGGGCAGATAACTGTTCCCCAGTGGCAGAAGAGGAGACTACTGGGTCCGCGGAGAGCGTGCTGCCCAAGGCGGAACCCTCAGCCGGAG

ATGGTCCGGTGCCCTATCCTCAGAGCTCTGGCTCGCTCATAATGCCACGGCCCAACTCAGTTGCAG - UNI11871 - CGACAAGTTCTACCAAATTG

GAAGACTTGAGTTATTTGGACGGACAGAGAAATGCTCCTCTTCGGACATCAATTAGATTGCCCTGGCACAATACGGCTGGAGGTAGGGCACCGGAAGTTA

AAG CACGGTTTGCTCCCTACAAACCTCAGGAGATCCTGTTGAAGCCCTTGCTGTTTGAAGTACCAAGCATCACAACTGACTCTGTGTTTGTGGGAAGAG

ATTGGCTCTTTCACCAGATAGAGGAAAACTTGAGGAACACAGAGCTGGCAGAAAACAGAGGAGCCGTGGTCGTGGGGAGCGTAGGATTTGGGAAGACAGC

CATCATTTCTAAGCTGGTGGCACTGAGCTGTCACGGAAGCCGCATGAGACAGATCGCATCCAGCAGTCCCAGTTTGTCACCCAAAT CCTCAGATCCCAC

TCAGGACCTTCCTGGTACTCCATTACTCTCACCAAGTTCTTCTACAAGTGCTCTCAGTGTGACCAGAACACCTGCTGGGCCTGGGACTGCTGACAGCCAG

AGACCGAGAGAGGATGCGGTGAAATACCTCGCTTCTAAG GTGGTGGCCTACCATTACTGCCAGGCTGACAACACTTACACATGTCTGGTACCTGAGTTT

GTGCACAGCATTGCTGCTTTGCTGTGCCGGTCCCACCAGCTGGCTGCCTACAGAGACCTTCTGATCAAGGAACCCCAGCTGCAGAGCATGCTGAGCCTCC

GCTCCTGTGTGCAGGATCCCGTGGCTGCTTTCAAGAGGGGCGTCCTGGAGCCACTTACAAGCCTAAGAAACG AGCAAAAAATTCCAGAAGAGGAGTATA

TCATCCTTATAGATGGCTTGAATGAAGCTGAGTTTCATAAGCCTGATTACGGAGATACGCTGTCTTCGTTTATTACCAAAATTATTCCTAAGTTCCCCAC

CTGGCTGAAGTTGATCGTGACCGTGAGAGCAAATTTTCAG - UNI28222 - GAAATCATCAGTGCACTGCCATTTGTCAAGCTTTCCCTAGACGACT

TTCCAGACAACAAGGACATTCACAGTGACCTGCACGCCTACGTCCAGCACAGGGTCCACAGCAGCCAGGACATCCTCAGCAACATCTCCCTGAATGGCAA

GGCCGACGCCGCCCTCATCAGCAAAGTCAGCAGCCATCTGGTGCTGCGGAGCCTCGGTTCCTACCTGTACCTCAAGCTCACGCTGGACCTCTTCCAGCGG

GGCCACCTGGTCATAAAGAGTGCCAGCTACAAGGTGGTGCCTGTGTCTCTGTCCGAGCTCTATCTGCTGCAGTGTAACATGAAGTTCATGACCCAGTCTG

CCTTTGACCGGGCCCTTCCCATTTTGAACGTGGCTCTTGCGTCCCTCCACCCCATGACGGATGAGCAGATATTTCAGGCTATCAACGCCGGCCACATCCA

AGGCGAGCAGGGCTGGGAGGACTTCCAGCAGAGGATGGAGGCCCTCTCTTGCTTCCTCATTAAGAGGAGGGACAAAACCCGCATGTTCTGCCACCCGTCC

TTCAGAGAGTGGCTGGTGTGGAGAGCGGATGGCGAAAGCACAGCCTTCCTGTGTGAGCCCAG GAACGGACACGCTCTACTGGCGTTCATGTTCTCTCGA

CAGGAGAGCAAGCTGAACCGCCAGCAGACCATGGAGCTTGGCCACCACATCCTGAAGGCACACATTTTCAAG GGCCTCAGTAAGAAGACTGGAGTCTCC

TCAAGCCATCTGCAGGCTCTGTGGATCGGTTACAGCACAGAGGGGCTGTCTGCTGCCCTGGCCTCTCTCAGGAATCTCTATACTCCCAACGTGAAG GTG

AGCCGGCTCCTGATTTTGGGAGGGGCCAACGTGAACTACAGGACAGAAGTGTTAAACAATGCCCCCATCCTGTGCGTCCAGTCTCACCTTGGCCATGAAG

AAGTTGTCACTCTCCTTCTGGAATTTGGCGCCTGCCTGGATGGGATGTCGGAGAACGGTATGAACGCACTGTGCTACGCAGCTGCTGCCGGCCACATGAA

GCTGGTGTGTCTGCTCATCAAGAAGGGGGCAAGG - UNI1206 - GTGGACCACTTGGATAAGAAGGGCCAGTGTGCACTCGTCCACAGCGCACTGAG

GGGCCACAGTGACATTCTCCAGTACCTGCTGAACTGTGAGTGGTCGGCAGGCCCTCCCCAGCCTGGCACCCTGAGGAAGAGCCAAGCCCTGCAGCAGGCA

CTGACAGCCGCCGCCAGCATGGGCCACAGCTCG - UNI5713 - GTCGTCCAGTCCTTGCTGGGAATGGCAGAGGAACATGAAATCGAAGTCAACGGC

ACCGACACGTTGTGGGGAGAAACAG - UNI9955 - CCCTGACGGCCGCTGCTGGGAGAGGAAAGGTGGAGATCTGCGAGCTGCTGCTGGAGCGTGGA

GCTGCCGTGTCTCGGGCCAACAGGAGAGGGGTTCCCCCTCTGTTTTGTGCCGCCCGCCAAGGCCATTGGCAG - UNI11853 - GTTGTCCGATTGCT

TTTGGATCGCGGCTGCGACGTGAACCTGAGTGACAAGCAGGGTCGAACACCTCTCATGGTGGCTTCCTGTGAGGGACACCTGAGCACCGTGGAATTCCTC

CTCTCAAAAG GTGCTGCTCTTTCTTCCCTGGACAAAGAGGGCCTGTCAGCATTGAGCTGGGCTTGTCTGAAGGGTCACAGGGCAGTGGTCCAGTACCTG

GTCGAAGAAGGAGCAGAGATAGACCAGACAGACAAAAACGGCCGTACTCCCTTGGACCTGGCCGCTTTCTATGGTGATGCAGAGACT GTGCTGTATCTG

GTGGAGAAGGGAGCCGTGATAGAACATGTGGACCACAGTGGGATGCGCCCCCTGGACAGAGCCATCGGCTGTCGAAACACTGCTGTAGTGGTTACCCTGC

TTAGAAAAGGAGCCAAACTAG - UNI9883 - GAAATGCCGCTTGGGCGATGGCCACTTCCAAGCCTGATATTTTGATTATACTTTTGCAGAAATTGG

TAGAGGAAGGAAATGTGATGTACAAG - UNI10164 - AAAGGGAAGATGAAGGAGGCAGCCCAGAGGTACCAGTATGCCTTGCGGAAGTTCCCTCGG

GAAGGACTCGGAGAAGACATGAGGCCGTTCAATGAACTGAGAGTCTCCCTCTATCTCAATCTGTCGCGATGCCGAAGGAAAACAAAC GACTTTGGTTTG

GCAGAAGAATTTGCTTCAAAGGCTCTGGAATTGAAACCCAAATCCTACGAAGCCTTTTATGCCCGGGCGAGAGCAAAAAGGAACAGCAG GCAGTTCCTG

GCAGCTCTGGCTGACCTGCAAGAGGCTGTGAAACTCTGTCCCAACAATCAGGAAATCAAGAGGCTCCTGGCCCGTGTTGAAGAAGAGTGCAAGCAACTCC

AGAGGAACCAGCAGCAAAAGCAGCAGGGTCCCCCACCAGCTCCAGCCAATGACTCGGATAATGAGGAGGATGCGCCAGCCTCTAGTTTAAAGGACCACTT

CCCCATTGAGGAGGCGGAAGAGGAAGACACCTCTTCACAGGAAGAGTCCATTTCCCCGACTCCCAGATCCCAGCCACCACCGTCTGTCCCTTCCCCATAC

ATCCGCAACCTTCAAGAGGGATTACAGTCCAAAGGCAGGTCAGCATCCCCACAGAGCAGGGCAGGAATCAGCAAGTCCCTGAGAGAGACTGTAGCCCAGT

CAGGCTTGGTTATGCAGCCTACCAAACAGGCACAGATAGTGAAGACCAACCAACATCTGGGTTCCGGGCAATCTAGCATGAGAAACAGTAGCACAAAAAT

ACAAGTTTCTTCTCAGAACCCTCCCCCGAGTCCGATGCCGGGTAGAGTATCTGCAGCCCCTGCCGTGAGCAGAAACCAGCATTTAGAGGGAACCGGTCCC

TTCACTGCAGGAACTGGTTGTGGCCACTTCGGGGATCGGCTGGGCGCCAGCCAGAGCCTCCAGCTGCAGCGCAGTGAGAGCGGCACTGCGTATCCTCTAC

CGAGCAAAGTCAAAGCTGCCGAGAGGCTCCTGGCTCATGCCTCCGTGGCCGTGGACATGGCTCCTCCAAACCAGGGCGGACCAGTGAGCTGTAGCGATGT

GCGGCACCCGGCTTCCCTCTCTAGCTCAGGCTCCTCTGGCTCTCCATCGAGCAGCATAAAGATGTCAAGTTCCACCAGTAGTTTGACTTCAAGCAGTAGC

GTTTCAGACGGATTCAAGGTCCAAGGACCAGACTCTCGGATCAGAGACAAAGGTACAACCCAGGTGCAGGGTGGCACTGCCGAACACAGGCCCCGCAACA

CTCCATTTATGGGCATCATGGACAAGACCGCCAGGTTCCAGCAGCAAAGCAATCCTCCGAACCGCTCCTGGCACTGCCCGGTGGCAGAGGGGCTACTGAC

AAACACAGCCACTGCAGCTGGCCTGCAGTCTAACTCTGAGAAACCCACTCTCAAGCCAGGAGGATACTGTAGCCAAGCCAAACCGTGTTCAGTTCCTCCC

CTGAGCATGGGTGTCCACAATGGGGCTCAGGTGAAGGAGCTGGAAGAGAACAAGTGCCAAATCCCAGCCCTCTGTCAAGATAACAGGATAACTAAGGGGG

TTCCTCATCTCTACCCAGAGGGCGTCTCTAAGCAGCCACTTCATGTCAGTACGGAAGCCCACAGGAGCCACCTCACTTCAGCAAAACCAAAGCGATCGTT

CATAGAGTCCAATGTGTGAGCCTTAAGCAACCCCTGTGTAGAATCTGGAGGCAGTCTGTTGGCTCGTGGTAATAAATGATGTCTCTTTTTCTTTTCATAA

TAAAAATTACATGTTAGCCATATTTTCCACCTCTTGGGTGGATCTGATGCCATTGACATATTAAAACTGTAGGATAAAACTATAATTAGTAGCTAGAAAT

CAGCCATAAACAGAAGTACTAAACAGCATTGAACACTGTTGTCAGCTTATATCTGGCGATTTAAAGGCTGCCAAGAAGACATCAACTGATGCCGTTCTCT

TAGGAGATTATTTGGCTTGCTCTGTGTAAAAGCACACGTACTTAGAGAAGGAAAAAAAAATCCACTGGTAAAAGTTAACTCCTGACATAATATCTGGAAA

ATTCTGGAAAAGATGGGGAGGGAGGGTGTTTAAGTTACAGATCCCTAAGTCAAACCTGTCCTTACATGTGTGTAAAAATCGCAACCTGAGTGATTTCTAG

CTGGATATAAATGTGACTTTTATCTGCAAAATACAAGCGCAGCCAAGTATCTTGTTGGTTCCTCGAGAGGATCAAACACCTACTTCCATGATATGGTGAA

TTGAAGAGTATTTTTATAGCCCCCTTTTTGGAACTATACTTAGGTTTCACCGTGTTGCTGATAAGACGAGAACAGGCTAGCTAGAATTTGGATTGGTGTC

CAGGTCAGAGTTGTGCAAAAGTACCAAGAGAAGCACTCTTAGTGACGGCCACAAATTAGCTCTAACTGGTTCCGAAAGTGTTCTGGACAGTGACGGTCCC

CAAAACAAGCCTCTAATGTCCTCTAGGGAAAGTGTTCAGACAGGACCCTTGAGGTCTGGGTGGCAGTTTTGATTTCCTTACACAGCCCGTTGTTTCATAG

TCATGTGTCATATATATATATAAATAGCTAGCCCATTTTATTCAGACTTGTAAATAACTCAAAGGAAGTTAATCTAAAGACAAATAACAGAACCCCGCCA

TCTCTCTGCATGTTCTCTGTACGCTCCATCATGCTGGTTGCCGCACTGAACGATGCGTTATCACGGCTTGTAACAGTATACCCGCAATGGCACTTTATCT

CCTGTGTATGGACACCTCTGAGGTGCTACTTAAATCCGAGTGACATATTTTTCACCTGTAAAGATAAGGTACAGGGATGAACCTTGGCTTAAGGTATTTT

TATATGAAAATGGTGTTATTGGAAGATGTTCAAATGCTGGTTTGAGAGAGGTGGGAGAAGTATTTTATATGTTGAGATGTGAAATGTATTTTCTAGAATC

GGGGAGAAGGAAGTTCTATATTTGCAGAATGTTTTAAACGTGAGTACCCACGATGCTCCTATGAACATCATTAAGGTTTTGTACGAAAAGGAACCTTGCC

GCGGCGTCATTTAGTGTGTCTGTTCCTGTGTGCAGAGGGCTTTGTACAAACAGCTAGGCCGTTTTTATAAGCTCTCTCTGAGTTCTGCTCCAGTTACTAT

GGCTTATTTATTGTTTTCCTTAATATTTGTGACAGTCTTACTCTTTCGTTATGTAGTTTGTTTCTGCACAACTACTGTACTTTTTCCACATGGAATAAAA

ACCATTACTCCAAGTGGGTTGGCATTCATTGCTCAGCGGGTAAGAAGGCAGGGACACCTCTCGTGGCTCTCTGCCTTGATTTGTCACCCTAAGGAGTAAA

AAGCACTTTGAATACACCAACAGCACGGGTTTTATTTTAATTTCAGAATAAGGTGGGAGCTTCTAGAAATTCCAAAGTACTCTAGTCTCATGATTTTTTT

TGCCTTAAATAGGAAAAATGCACGGGACGAGCAGTGTGGACTAATGGGTCTCGCTGGTCACAGATACTTGTACCCTGTAACCGCCAGTGCACCGTGCCCT

CTCAGGACAGCTGCGTCTTCCAGCACATTTGCAGTGTCTTCTCATTGAAACTGTCTGTCTTTATGACCACAGATTTGTCTCAAACTGTGTAAGAATAGAG

ATTGTTTTGGTTGTATCATGATAAAATTCTTACTTGAAGTATTTT
Translation
 - UNI8198 -  - UNI1525 - - UNI13559 - - UNI17236 - MLKAVLKKSREGGKGSKKEAG - UNI6463 - - UNI13559 - -

 UNI27382 - - UNI29755 - GGDFGSETPALSSSGDSPVNSLSTTEDTYRVSLAKGVSMSLPSSPLLPRQSLLTQSRSNKKSPG - UNI170 -

 - UNI680 - - UNI21183 - - UNI27382 - - UNI29633 - GPVRKPKYVESPRVPGDPVMIPFGEGSKPSEPSATE - UNI680 - -

 UNI5444 - - UNI21183 - EAKADNEPSCSPAAQELLTRLGFLLGEGIPSATHITIEDKNEAM - UNI5444 - - UNI9951 - CTALSQG

ISPCSTLTSSTASPSTDSPCSTLNSCVSKTAASKSPCETISSPSSTLESKDSGIIA - UNI402 - - UNI11871 - ATITSSSENDDRSGSSLEW

NRDGSLRLGVQKGVLHDRRADNCSPVAEEETTGSAESVLPKAEPSAGDGPVPYPQSSGSLIMPRPNSVAA - UNI11871 - ATSSTKLEDLSYLDGQ

RNAPLRTSIRLPWHNTAGGRAPEVKA ARFAPYKPQEILLKPLLFEVPSITTDSVFVGRDWLFHQIEENLRNTELAENRGAVVVGSVGFGKTAIISKLVA

LSCHGSRMRQIASSSPSLSPKS SSDPTQDLPGTPLLSPSSSTSALSVTRTPAGPGTADSQRPREDAVKYLASK VVAYHYCQADNTYTCLVPEFVHSIA

ALLCRSHQLAAYRDLLIKEPQLQSMLSLRSCVQDPVAAFKRGVLEPLTSLRNE EQKIPEEEYIILIDGLNEAEFHKPDYGDTLSSFITKIIPKFPTWLK

LIVTVRANFQ - UNI28222 - EIISALPFVKLSLDDFPDNKDIHSDLHAYVQHRVHSSQDILSNISLNGKADAALISKVSSHLVLRSLGSYLYLKLT

LDLFQRGHLVIKSASYKVVPVSLSELYLLQCNMKFMTQSAFDRALPILNVALASLHPMTDEQIFQAINAGHIQGEQGWEDFQQRMEALSCFLIKRRDKTR

MFCHPSFREWLVWRADGESTAFLCEPR RNGHALLAFMFSRQESKLNRQQTMELGHHILKAHIFK GLSKKTGVSSSHLQALWIGYSTEGLSAALASLRN

LYTPNVK VSRLLILGGANVNYRTEVLNNAPILCVQSHLGHEEVVTLLLEFGACLDGMSENGMNALCYAAAAGHMKLVCLLIKKGAR - UNI1206 - 

VDHLDKKGQCALVHSALRGHSDILQYLLNCEWSAGPPQPGTLRKSQALQQALTAAASMGHSS - UNI5713 - VVQSLLGMAEEHEIEVNGTDTLWGE

TA - UNI9955 - ALTAAAGRGKVEICELLLERGAAVSRANRRGVPPLFCAARQGHWQ - UNI11853 - VVRLLLDRGCDVNLSDKQGRTPLMVA

SCEGHLSTVEFLLSKG GAALSSLDKEGLSALSWACLKGHRAVVQYLVEEGAEIDQTDKNGRTPLDLAAFYGDAET VLYLVEKGAVIEHVDHSGMRPLD

RAIGCRNTAVVVTLLRKGAKLG - UNI9883 - GNAAWAMATSKPDILIILLQKLVEEGNVMYK - UNI10164 - KGKMKEAAQRYQYALRKFPR

EGLGEDMRPFNELRVSLYLNLSRCRRKTN DFGLAEEFASKALELKPKSYEAFYARARAKRNSR RQFLAALADLQEAVKLCPNNQEIKRLLARVEEECK

QLQRNQQQKQQGPPPAPANDSDNEEDAPASSLKDHFPIEEAEEEDTSSQEESISPTPRSQPPPSVPSPYIRNLQEGLQSKGRSASPQSRAGISKSLRETV

AQSGLVMQPTKQAQIVKTNQHLGSGQSSMRNSSTKIQVSSQNPPPSPMPGRVSAAPAVSRNQHLEGTGPFTAGTGCGHFGDRLGASQSLQLQRSESGTAY

PLPSKVKAAERLLAHASVAVDMAPPNQGGPVSCSDVRHPASLSSSGSSGSPSSSIKMSSSTSSLTSSSSVSDGFKVQGPDSRIRDKGTTQVQGGTAEHRP

RNTPFMGIMDKTARFQQQSNPPNRSWHCPVAEGLLTNTATAAGLQSNSEKPTLKPGGYCSQAKPCSVPPLSMGVHNGAQVKELEENKCQIPALCQDNRIT

KGVPHLYPEGVSKQPLHVSTEAHRSHLTSAKPKRSFIESNV
Transcript ENSMUST00000056900
Sequence
GAGGTTTCGAGCAGTGTCTGTTTTCTGCTTGCCAGCTGAGAGTTGAGACCGGTTGGAACTTTTGCAGTGTTGGGGGATGAAGAACAGCGGCTTCATTCTC

GGCAGTGACAAGAGAACGCAGTGAGGCAGAG - UNI680 - - UNI21183 - - UNI29633 - GTCCCGTCAGGAAGCCCAAGTATGTGGAAAG

CCCCAGGGTGCCGGGAGATCCAGTTATGATCCCGTTCGGAGAAGGGTCCAAGCCCTCAGAGCCCAGTGCGACTG - UNI680 - - UNI5444 - - 

UNI21183 - AAGCGAAGGCTGATAATGAACCGAGCTGCTCTCCAGCAGCTCAAGAACTGTTGACAAGGCTGGGATTTCTACTGGGAGAGGGGATCCCG

AGCGCCACACACATAACCATTGAAGACAAAAATGAAGCCATG - UNI5444 - - UNI9951 - TGCACAGCCCTGAGTCAAGGCATCAGCCCTTGT

TCCACACTCACAAGCAGCACTGCCTCTCCCAGCACCGACAGCCCCTGCTCGACCTTGAATAGCTGTGTCAGCAAGACGGCAGCCAGCAAAAGTCCCTGCG

AGACCATTAGCAGCCCCAGTTCCACCCTGGAAAGCAAGGACAGTGGAATTATAG - UNI402 - - UNI11871 - CCACAATCACAAGTTCATCGG

AAAATGATGACCGGAGTGGCTCCAGTCTGGAATGGAACAGAGACGGAAGCCTAAGGTTAGGGGTTCAGAAGGGAGTGCTTCATGACCGAAGGGCAGATAA

CTGTTCCCCAGTGGCAGAAGAGGAGACTACTGGGTCCGCGGAGAGCGTGCTGCCCAAGGCGGAACCCTCAGCCGGAGATGGTCCGGTGCCCTATCCTCAG

AGCTCTGGCTCGCTCATAATGCCACGGCCCAACTCAGTTGCAG - UNI11871 - CGACAAGTTCTACCAAATTGGAAGACTTGAGTTATTTGGACGG

ACAGAGAAATGCTCCTCTTCGGACATCAATTAGATTGCCCTGGCACAATACGGCTGGAGGTAGGGCACCGGAAGTTAAAG CACGGTTTGCTCCCTACAA

ACCTCAGGAGATCCTGTTGAAGCCCTTGCTGTTTGAAGTACCAAGCATCACAACTGACTCTGTGTTTGTGGGAAGAGATTGGCTCTTTCACCAGATAGAG

GAAAACTTGAGGAACACAGAGCTGGCAGAAAACAGAGGAGCCGTGGTCGTGGGGAGCGTAGGATTTGGGAAGACAGCCATCATTTCTAAGCTGGTGGCAC

TGAGCTGTCACGGAAGCCGCATGAGACAGATCGCATCCAGCAGTCCCAGTTTGTCACCCAAAT CCTCAGATCCCACTCAGGACCTTCCTGGTACTCCAT

TACTCTCACCAAGTTCTTCTACAAGTGCTCTCAGTGTGACCAGAACACCTGCTGGGCCTGGGACTGCTGACAGCCAGAGACCGAGAGAGGATGCGGTGAA

ATACCTCGCTTCTAAG GTGGTGGCCTACCATTACTGCCAGGCTGACAACACTTACACATGTCTGGTACCTGAGTTTGTGCACAGCATTGCTGCTTTGCT

GTGCCGGTCCCACCAGCTGGCTGCCTACAGAGACCTTCTGATCAAGGAACCCCAGCTGCAGAGCATGCTGAGCCTCCGCTCCTGTGTGCAGGATCCCGTG

GCTGCTTTCAAGAGGGGCGTCCTGGAGCCACTTACAAGCCTAAGAAACG AGCAAAAAATTCCAGAAGAGGAGTATATCATCCTTATAGATGGCTTGAAT

GAAGCTGAGTTTCATAAGCCTGATTACGGAGATACGCTGTCTTCGTTTATTACCAAAATTATTCCTAAGTTCCCCACCTGGCTGAAGTTGATCGTGACCG

TGAGAGCAAATTTTCAG - UNI28222 - GAAATCATCAGTGCACTGCCATTTGTCAAGCTTTCCCTAGACGACTTTCCAGACAACAAGGACATTCAC

AGTGACCTGCACGCCTACGTCCAGCACAGGGTCCACAGCAGCCAGGACATCCTCAGCAACATCTCCCTGAATGGCAAGGCCGACGCCGCCCTCATCAGCA

AAGTCAGCAGCCATCTGGTGCTGCGGAGCCTCGGTTCCTACCTGTACCTCAAGCTCACGCTGGACCTCTTCCAGCGGGGCCACCTGGTCATAAAGAGTGC

CAGCTACAAGGTGGTGCCTGTGTCTCTGTCCGAGCTCTATCTGCTGCAGTGTAACATGAAGTTCATGACCCAGTCTGCCTTTGACCGGGCCCTTCCCATT

TTGAACGTGGCTCTTGCGTCCCTCCACCCCATGACGGATGAGCAGATATTTCAGGCTATCAACGCCGGCCACATCCAAGGCGAGCAGGGCTGGGAGGACT

TCCAGCAGAGGATGGAGGCCCTCTCTTGCTTCCTCATTAAGAGGAGGGACAAAACCCGCATGTTCTGCCACCCGTCCTTCAGAGAGTGGCTGGTGTGGAG

AGCGGATGGCGAAAGCACAGCCTTCCTGTGTGAGCCCAG GAACGGACACGCTCTACTGGCGTTCATGTTCTCTCGACAGGAGAGCAAGCTGAACCGCCA

GCAGACCATGGAGCTTGGCCACCACATCCTGAAGGCACACATTTTCAAG GGCCTCAGTAAGAAGACTGGAGTCTCCTCAAGCCATCTGCAGGCTCTGTG

GATCGGTTACAGCACAGAGGGGCTGTCTGCTGCCCTGGCCTCTCTCAGGAATCTCTATACTCCCAACGTGAAG GTGAGCCGGCTCCTGATTTTGGGAGG

GGCCAACGTGAACTACAGGACAGAAGTGTTAAACAATGCCCCCATCCTGTGCGTCCAGTCTCACCTTGGCCATGAAGAAGTTGTCACTCTCCTTCTGGAA

TTTGGCGCCTGCCTGGATGGGATGTCGGAGAACGGTATGAACGCACTGTGCTACGCAGCTGCTGCCGGCCACATGAAGCTGGTGTGTCTGCTCATCAAGA

AGGGGGCAAGG - UNI1206 - GTGGACCACTTGGATAAGAAGGGCCAGTGTGCACTCGTCCACAGCGCACTGAGGGGCCACAGTGACATTCTCCAGT

ACCTGCTGAACTGTGAGTGGTCGGCAGGCCCTCCCCAGCCTGGCACCCTGAGGAAGAGCCAAGCCCTGCAGCAGGCACTGACAGCCGCCGCCAGCATGGG

CCACAGCTCG - UNI5713 - GTCGTCCAGTCCTTGCTGGGAATGGCAGAGGAACATGAAATCGAAGTCAACGGCACCGACACGTTGTGGGGAGAAAC

AGGTAATTATGCTTCCAGTGTTTGTAGTCAGCAGCCGCGTGCGTGACGTCCCAGCCCCGCTGTGGCCTGATCGCCTTAGAGTGGCTGGTGATGCATATAC

TCCTGTTTTCGTTTTGTCACGAGGCATTTGAAGCCTAAAGCCTTTTCAACTTGCCAAATGAGTAGTGGAACTCTGGAAGTAGTGAAAGGGACTCCTTTTG

AGTTAGACGGGCTGTTACCCCGTGCACTTGAGGGCAACCGGCACACGTGTTTAATCCCAGCACTTGGGAGGTAGAGGCAGGCGGATTTCTGAGTTCAAGG

CCAGCCAGCACTATACAGAGAAACCCTGTCTTGAAAAACCAAAAAAAAAAAAAAGAAAAAAAAAAAGAAAAAAGAAATGCCTTAGTAAGGCTTCATGTTC

ACACACGTCCCAACCCACCCGATCCTTCCTTGAAGCCTGGCTAAGGAATCCAGGCAGCAGGTCCATCATCAAGCAAATCAAAGATGGCTCAGTAGGGAAA

GTGTGACTCAATGTGTCTTGTGGAATGAGGACAGAGCTCAGGTCTCACAGACCCGTCTAAAATACTTAATACAGTCTGGAGTCCCTCCCAGTTGGTCAAG

GTAGGAGGGCTGCCTGACTTAGTGGGGAAAAAGATTAATATTAAAATTAATGAAGTTACTGCTGCTTTGAAATTTTCCATTCGACAGATGTAACCAAGGT

GCTTTCCCGGCTTCATACGTGATGCATTTGGATGCTTTATTTATTTATTATTTATTTATTTATTGCACAGATTTGTTTCTGACTTCTTCTAGGTTATTTT

CTTAACAGAACAGATGGTGGTGTGGAGAGTTTATTAGCTAGTTCACACTTGAGAGAAACCTTAGAGATTTTCCTGGTGGGAGAGCAGGCCTGCCCTCCAG

AGCCACATGGCCTGCTCTTGGAAGCCACCATCAGCTGGCTTCCTATGGCTTGCTATGGACTGGAGGAGGAGTGAGCCATGGTGTGAGTTACAGAGACAGT

GTAGATCCAGATGGTGTGGATCAGCCCCTTCCCCACTGAGATTCTGCCAGTTGGTTGATGTCTGAAGAGACACTTGAAAAATTAAAGACTTCTCACTT
Translation
 - UNI680 - - UNI21183 - - UNI29633 - MIPFGEGSKPSEPSATE - UNI680 - - UNI5444 - - UNI21183 - EAKADNEP

SCSPAAQELLTRLGFLLGEGIPSATHITIEDKNEAM - UNI5444 - - UNI9951 - CTALSQGISPCSTLTSSTASPSTDSPCSTLNSCVSKTAA

SKSPCETISSPSSTLESKDSGIIA - UNI402 - - UNI11871 - ATITSSSENDDRSGSSLEWNRDGSLRLGVQKGVLHDRRADNCSPVAEEETT

GSAESVLPKAEPSAGDGPVPYPQSSGSLIMPRPNSVAA - UNI11871 - ATSSTKLEDLSYLDGQRNAPLRTSIRLPWHNTAGGRAPEVKA ARFAP

YKPQEILLKPLLFEVPSITTDSVFVGRDWLFHQIEENLRNTELAENRGAVVVGSVGFGKTAIISKLVALSCHGSRMRQIASSSPSLSPKS SSDPTQDLP

GTPLLSPSSSTSALSVTRTPAGPGTADSQRPREDAVKYLASK VVAYHYCQADNTYTCLVPEFVHSIAALLCRSHQLAAYRDLLIKEPQLQSMLSLRSCV

QDPVAAFKRGVLEPLTSLRNE EQKIPEEEYIILIDGLNEAEFHKPDYGDTLSSFITKIIPKFPTWLKLIVTVRANFQ - UNI28222 - EIISALPF

VKLSLDDFPDNKDIHSDLHAYVQHRVHSSQDILSNISLNGKADAALISKVSSHLVLRSLGSYLYLKLTLDLFQRGHLVIKSASYKVVPVSLSELYLLQCN

MKFMTQSAFDRALPILNVALASLHPMTDEQIFQAINAGHIQGEQGWEDFQQRMEALSCFLIKRRDKTRMFCHPSFREWLVWRADGESTAFLCEPR RNGH

ALLAFMFSRQESKLNRQQTMELGHHILKAHIFK GLSKKTGVSSSHLQALWIGYSTEGLSAALASLRNLYTPNVK VSRLLILGGANVNYRTEVLNNAPI

LCVQSHLGHEEVVTLLLEFGACLDGMSENGMNALCYAAAAGHMKLVCLLIKKGAR - UNI1206 - VDHLDKKGQCALVHSALRGHSDILQYLLNCEW

SAGPPQPGTLRKSQALQQALTAAASMGHSS - UNI5713 - VVQSLLGMAEEHEIEVNGTDTLWGETGNYASSVCSQQPRA
Transcript ENSMUST00000112568
Sequence
GGGGACGGGCCGGAGCGCTGCCTCCGCGGTGGCAGCTGCGGGAGCCCGGCTCGGGAGCCGCAGGAGCCGCAGCCGCCAAGCGCCCAGCCCTCTGCGCCCT

GAGGCTCGGCCCCCGGGGTGGGAACCGCGCCGAAAGCTGGAAACTTTCCTGGCAG - UNI8198 - GAGCTGACTGTTGGGCACAGAGGAAGGACAGG

AGAGAGAGCTGAGACATAAGGACCACTGTACCGCGTTTCTTCCTTCCATGAATGAGAAGATACCAGAGATAG - UNI1525 - - UNI13559 - - 

UNI17236 - AGACAAAAGACTGTTGAAAATGCTGAAGGCTGTGCTGAAGAAGAGCCGAGAGGGAGGAAAGGGAAGCAAGAAGGAAGCAG - UNI646

3 - - UNI13559 - - UNI27382 - - UNI29755 - GAGGTGACTTTGGCTCAGAGACGCCTGCCTTGTCCTCCAGTGGTGACTCTCCTGTGA

ACAGTTTGTCCACAACAGAGGACACTTATCGTGTGAGCTTGGCCAAAGGGGTCTCTATGTCTCTTCCTTCATCACCTTTGCTGCCTCGACAATCTCTCCT

GACACAGTCAAGATCGAACAAAAAATCTCCAG - UNI170 - - UNI680 - - UNI21183 - - UNI27382 - - UNI29633 - GTCCCG

TCAGGAAGCCCAAGTATGTGGAAAGCCCCAGGGTGCCGGGAGATCCAGTTATGATCCCGTTCGGAGAAGGGTCCAAGCCCTCAGAGCCCAGTGCGACTG 

- UNI680 - - UNI5444 - - UNI21183 - AAGCGAAGGCTGATAATGAACCGAGCTGCTCTCCAGCAGCTCAAGAACTGTTGACAAGGCTGGG

ATTTCTACTGGGAGAGGGGATCCCGAGCGCCACACACATAACCATTGAAGACAAAAATGAAGCCATG - UNI5444 - - UNI9951 - TGCACAGC

CCTGAGTCAAGGCATCAGCCCTTGTTCCACACTCACAAGCAGCACTGCCTCTCCCAGCACCGACAGCCCCTGCTCGACCTTGAATAGCTGTGTCAGCAAG

ACGGCAGCCAGCAAAAGTCCCTGCGAGACCATTAGCAGCCCCAGTTCCACCCTGGAAAGCAAGGACAGTGGAATTATAG - UNI402 - - UNI1187

1 - CCACAATCACAAGTTCATCGGAAAATGATGACCGGAGTGGCTCCAGTCTGGAATGGAACAGAGACGGAAGCCTAAGGTTAGGGGTTCAGAAGGGAG

TGCTTCATGACCGAAGGGCAGATAACTGTTCCCCAGTGGCAGAAGAGGAGACTACTGGGTCCGCGGAGAGCGTGCTGCCCAAGGCGGAACCCTCAGCCGG

AGATGGTCCGGTGCCCTATCCTCAGAGCTCTGGCTCGCTCATAATGCCACGGCCCAACTCAGTTGCAG - UNI11871 - CGACAAGTTCTACCAAAT

TGGAAGACTTGAGTTATTTGGACGGACAGAGAAATGCTCCTCTTCGGACATCAATTAGATTGCCCTGGCACAATACGGCTGGAG CACGGTTTGCTCCCT

ACAAACCTCAGGAGATCCTGTTGAAGCCCTTGCTGTTTGAAGTACCAAGCATCACAACTGACTCTGTGTTTGTGGGAAGAGATTGGCTCTTTCACCAGAT

AGAGGAAAACTTGAGGAACACAGAGCTGGCAGAAAACAGAGGAGCCGTGGTCGTGGGGAGCGTAGGATTTGGGAAGACAGCCATCATTTCTAAGCTGGTG

GCACTGAGCTGTCACGGAAGCCGCATGAGACAGATCGCATCCAGCAGTCCCAGTTTGTCACCCAAAT CCTCAGATCCCACTCAGGACCTTCCTGGTACT

CCATTACTCTCACCAAGTTCTTCTACAAGTGCTCTCAGTGTGACCAGAACACCTGCTGGGCCTGGGACTGCTGACAGCCAGAGACCGAGAGAGGATGCGG

TGAAATACCTCGCTTCTAAG GTGGTGGCCTACCATTACTGCCAGGCTGACAACACTTACACATGTCTGGTACCTGAGTTTGTGCACAGCATTGCTGCTT

TGCTGTGCCGGTCCCACCAGCTGGCTGCCTACAGAGACCTTCTGATCAAGGAACCCCAGCTGCAGAGCATGCTGAGCCTCCGCTCCTGTGTGCAGGATCC

CGTGGCTGCTTTCAAGAGGGGCGTCCTGGAGCCACTTACAAGCCTAAGAAACG AGCAAAAAATTCCAGAAGAGGAGTATATCATCCTTATAGATGGCTT

GAATGAAGCTGAGTTTCATAAGCCTGATTACGGAGATACGCTGTCTTCGTTTATTACCAAAATTATTCCTAAGTTCCCCACCTGGCTGAAGTTGATCGTG

ACCGTGAGAGCAAATTTTCAG - UNI28222 - GAAATCATCAGTGCACTGCCATTTGTCAAGCTTTCCCTAGACGACTTTCCAGACAACAAGGACAT

TCACAGTGACCTGCACGCCTACGTCCAGCACAGGGTCCACAGCAGCCAGGACATCCTCAGCAACATCTCCCTGAATGGCAAGGCCGACGCCGCCCTCATC

AGCAAAGTCAGCAGCCATCTGGTGCTGCGGAGCCTCGGTTCCTACCTGTACCTCAAGCTCACGCTGGACCTCTTCCAGCGGGGCCACCTGGTCATAAAGA

GTGCCAGCTACAAGGTGGTGCCTGTGTCTCTGTCCGAGCTCTATCTGCTGCAGTGTAACATGAAGTTCATGACCCAGTCTGCCTTTGACCGGGCCCTTCC

CATTTTGAACGTGGCTCTTGCGTCCCTCCACCCCATGACGGATGAGCAGATATTTCAGGCTATCAACGCCGGCCACATCCAAGGCGAGCAGGGCTGGGAG

GACTTCCAGCAGAGGATGGAGGCCCTCTCTTGCTTCCTCATTAAGAGGAGGGACAAAACCCGCATGTTCTGCCACCCGTCCTTCAGAGAGTGGCTGGTGT

GGAGAGCGGATGGCGAAAGCACAGCCTTCCTGTGTGAGCCCAG GAACGGACACGCTCTACTGGCGTTCATGTTCTCTCGACAGGAGAGCAAGCTGAACC

GCCAGCAGACCATGGAGCTTGGCCACCACATCCTGAAGGCACACATTTTCAAG GGCCTCAGTAAGAAGACTGGAGTCTCCTCAAGCCATCTGCAGGCTC

TGTGGATCGGTTACAGCACAGAGGGGCTGTCTGCTGCCCTGGCCTCTCTCAGGAATCTCTATACTCCCAACGTGAAG GTGAGCCGGCTCCTGATTTTGG

GAGGGGCCAACGTGAACTACAGGACAGAAGTGTTAAACAATGCCCCCATCCTGTGCGTCCAGTCTCACCTTGGCCATGAAGAAGTTGTCACTCTCCTTCT

GGAATTTGGCGCCTGCCTGGATGGGATGTCGGAGAACGGTATGAACGCACTGTGCTACGCAGCTGCTGCCGGCCACATGAAGCTGGTGTGTCTGCTCATC

AAGAAGGGGGCAAGG - UNI1206 - GTGGACCACTTGGATAAGAAGGGCCAGTGTGCACTCGTCCACAGCGCACTGAGGGGCCACAGTGACATTCTC

CAGTACCTGCTGAACTGTGAGTGGTCGGCAGGCCCTCCCCAGCCTGGCACCCTGAGGAAGAGCCAAGCCCTGCAGCAGGCACTGACAGCCGCCGCCAGCA

TGGGCCACAGCTCG - UNI5713 - GTCGTCCAGTCCTTGCTGGGAATGGCAGAGGAACATGAAATCGAAGTCAACGGCACCGACACGTTGTGGGGAG

AAACAG - UNI9955 - CCCTGACGGCCGCTGCTGGGAGAGGAAAGGTGGAGATCTGCGAGCTGCTGCTGGAGCGTGGAGCTGCCGTGTCTCGGGCCA

ACAGGAGAGGGGTTCCCCCTCTGTTTTGTGCCGCCCGCCAAGGCCATTGGCAG - UNI11853 - GTTGTCCGATTGCTTTTGGATCGCGGCTGCGAC

GTGAACCTGAGTGACAAGCAGGGTCGAACACCTCTCATGGTGGCTTCCTGTGAGGGACACCTGAGCACCGTGGAATTCCTCCTCTCAAAAG GTGCTGCT

CTTTCTTCCCTGGACAAAGAGGGCCTGTCAGCATTGAGCTGGGCTTGTCTGAAGGGTCACAGGGCAGTGGTCCAGTACCTGGTCGAAGAAGGAGCAGAGA

TAGACCAGACAGACAAAAACGGCCGTACTCCCTTGGACCTGGCCGCTTTCTATGGTGATGCAGAGACT GTGCTGTATCTGGTGGAGAAGGGAGCCGTGA

TAGAACATGTGGACCACAGTGGGATGCGCCCCCTGGACAGAGCCATCGGCTGTCGAAACACTGCTGTAGTGGTTACCCTGCTTAGAAAAGGAGCCAAACT

AG - UNI9883 - GAAATGCCGCTTGGGCGATGGCCACTTCCAAGCCTGATATTTTGATTATACTTTTGCAGAAATTGGTAGAGGAAGGAAATGTGAT

GTACAAG - UNI10164 - AAAGGGAAGATGAAGGAGGCAGCCCAGAGGTACCAGTATGCCTTGCGGAAGTTCCCTCGGGAAGGACTCGGAGAAGACA

TGAGGCCGTTCAATGAACTGAGAGTCTCCCTCTATCTCAATCTGTCGCGATGCCGAAGGAAAACAAAC GACTTTGGTTTGGCAGAAGAATTTGCTTCAA

AGGCTCTGGAATTGAAACCCAAATCCTACGAAGCCTTTTATGCCCGGGCGAGAGCAAAAAGGAACAGCAG GCAGTTCCTGGCAGCTCTGGCTGACCTGC

AAGAGGCTGTGAAACTCTGTCCCAACAATCAGGAAATCAAGAGGCTCCTGGCCCGTGTTGAAGAAGAGTGCAAGCAACTCCAGAGGAACCAGCAGCAAAA

GCAGCAGGGTCCCCCACCAGCTCCAGCCAATGACTCGGATAATGAGGAGGATGCGCCAGCCTCTAGTTTAAAGGACCACTTCCCCATTGAGGAGGCGGAA

GAGGAAGACACCTCTTCACAGGAAGAGTCCATTTCCCCGACTCCCAGATCCCAGCCACCACCGTCTGTCCCTTCCCCATACATCCGCAACCTTCAAGAGG

GATTACAGTCCAAAGGCAGGTCAGCATCCCCACAGAGCAGGGCAGGAATCAGCAAGTCCCTGAGAGAGACTGTAGCCCAGTCAGGCTTGGTTATGCAGCC

TACCAAACAGGCACAGATAGTGAAGACCAACCAACATCTGGGTTCCGGGCAATCTAGCATGAGAAACAGTAGCACAAAAATACAAGTTTCTTCTCAGAAC

CCTCCCCCGAGTCCGATGCCGGGTAGAGTATCTGCAGCCCCTGCCGTGAGCAGAAACCAGCATTTAGAGGGAACCGGTCCCTTCACTGCAGGAACTGGTT

GTGGCCACTTCGGGGATCGGCTGGGCGCCAGCCAGAGCCTCCAGCTGCAGCGCAGTGAGAGCGGCACTGCGTATCCTCTACCGAGCAAAGTCAAAGCTGC

CGAGAGGCTCCTGGCTCATGCCTCCGTGGCCGTGGACATGGCTCCTCCAAACCAGGGCGGACCAGTGAGCTGTAGCGATGTGCGGCACCCGGCTTCCCTC

TCTAGCTCAGGCTCCTCTGGCTCTCCATCGAGCAGCATAAAGATGTCAAGTTCCACCAGTAGTTTGACTTCAAGCAGTAGCGTTTCAGACGGATTCAAGG

TCCAAGGACCAGACTCTCGGATCAGAGACAAAGGTACAACCCAGGTGCAGGGTGGCACTGCCGAACACAGGCCCCGCAACACTCCATTTATGGGCATCAT

GGACAAGACCGCCAGGTTCCAGCAGCAAAGCAATCCTCCGAACCGCTCCTGGCACTGCCCGGTGGCAGAGGGGCTACTGACAAACACAGCCACTGCAGCT

GGCCTGCAGTCTAACTCTGAGAAACCCACTCTCAAGCCAGGAGGATACTGTAGCCAAGCCAAACCGTGTTCAGTTCCTCCCCTGAGCATGGGTGTCCACA

ATGGGGCTCAGGTGAAGGAGCTGGAAGAGAACAAGTGCCAAATCCCAGCCCTCTGTCAAGATAACAGGATAACTAAGGGGGTTCCTCATCTCTACCCAGA

GGGCGTCTCTAAGCAGCCACTTCATGTCAGTACGGAAGCCCACAGGAGCCACCTCACTTCAGCAAAACCAAAGCGATCGTTCATAGAGTCCAATGTGTGA

GCCTTAAGCAACCCCTGTGTAGAATCTGGAGGCAGTCTGTTGGCTCGTGGTAATAAATGATGTCTCTTTTTCTTTTCATAATAAAAATTACATGTTAGCC

ATATTTTCCACCTCTTGGGTGGATCTGATGCCATTGACATATTAAAACTGTAGGATAAAACTATAATTAGTAGCTAGAAATCAGCCATAAACAGAAGTAC

TAAACAGCATTGAACACTGTTGTCAGCTTATATCTGGCGATTTAAAGGCTGCCAAGAAGACATCAACTGATGCCGTTCTCTTAGGAGATTATTTGGCTTG

CTCTGTGTAAAAGCACACGTACTTAGAGAAGGAAAAAAAAATCCACTGGTAAAAGTTAACTCCTGACATAATATCTGGAAAATTCTGGAAAAGATGGGGA

GGGAGGGTGTTTAAGTTACAGATCCCTAAGTCAAACCTGTCCTTACATGTGTGTAAAAATCGCAACCTGAGTGATTTCTAGCTGGATATAAATGTGACTT

TTATCTGCAAAATACAAGCGCAGCCAAGTATCTTGTTGGTTCCTCGAGAGGATCAAACACCTACTTCCATGATATGGTGAATTGAAGAGTATTTTTATAG

CCCCCTTTTTGGAACTATACTTAGGTTTCACCGTGTTGCTGATAAGACGAGAACAGGCTAGCTAGAATTTGGATTGGTGTCCAGGTCAGAGTTGTGCAAA

AGTACCAAGAGAAGCACTCTTAGTGACGGCCACAAATTAGCTCTAACTGGTTCCGAAAGTGTTCTGGACAGTGACGGTCCCCAAAACAAGCCTCTAATGT

CCTCTAGGGAAAGTGTTCAGACAGGACCCTTGAGGTCTGGGTGGCAGTTTTGATTTCCTTACACAGCCCGTTGTTTCATAGTCATGTGTCATATATATAT

ATAAATAGCTAGCCCATTTTATTCAGACTTGTAAATAACTCAAAGGAAGTTAATCTAAAGACAAATAACAGAACCCCGCCATCTCTCTGCATGTTCTCTG

TACGCTCCATCATGCTGGTTGCCGCACTGAACGATGCGTTATCACGGCTTGTAACAGTATACCCGCAATGGCACTTTATCTCCTGTGTATGGACACCTCT

GAGGTGCTACTTAAATCCGAGTGACATATTTTTCACCTGTAAAGATAAGGTACAGGGATGAACCTTGGCTTAAGGTATTTTTATATGAAAATGGTGTTAT

TGGAAGATGTTCAAATGCTGGTTTGAGAGAGGTGGGAGAAGTATTTTATATGTTGAGATGTGAAATGTATTTTCTAGAATCGGGGAGAAGGAAGTTCTAT

ATTTGCAGAATGTTTTAAACGTGAGTACCCACGATGCTCCTATGAACATCATTAAGGTTTTGTACGAAAAGGAACCTTGCCGCGGCGTCATTTAGTGTGT

CTGTTCCTGTGTGCAGAGGGCTTTGTACAAACAGCTAGGCCGTTTTTATAAGCTCTCTCTGAGTTCTGCTCCAGTTACTATGGCTTATTTATTGTTTTCC

TTAATATTTGTGACAGTCTTACTCTTTCGTTATGTAGTTTGTTTCTGCACAACTACTGTACTTTTTCCACATGGAATAAAAACCATTACTCCAA
Translation
 - UNI8198 -  - UNI1525 - - UNI13559 - - UNI17236 -  - UNI6463 - - UNI13559 - - UNI27382 - - UNI2975

5 -  - UNI170 - - UNI680 - - UNI21183 - - UNI27382 - - UNI29633 -  - UNI680 - - UNI5444 - - UNI21183

 -  - UNI5444 - - UNI9951 -  - UNI402 - - UNI11871 -  - UNI11871 -    MLSLRSCVQDPVAAFKRGVLEPLTSLRNE 

EQKIPEEEYIILIDGLNEAEFHKPDYGDTLSSFITKIIPKFPTWLKLIVTVRANFQ - UNI28222 - EIISALPFVKLSLDDFPDNKDIHSDLHAYV

QHRVHSSQDILSNISLNGKADAALISKVSSHLVLRSLGSYLYLKLTLDLFQRGHLVIKSASYKVVPVSLSELYLLQCNMKFMTQSAFDRALPILNVALAS

LHPMTDEQIFQAINAGHIQGEQGWEDFQQRMEALSCFLIKRRDKTRMFCHPSFREWLVWRADGESTAFLCEPR RNGHALLAFMFSRQESKLNRQQTMEL

GHHILKAHIFK GLSKKTGVSSSHLQALWIGYSTEGLSAALASLRNLYTPNVK VSRLLILGGANVNYRTEVLNNAPILCVQSHLGHEEVVTLLLEFGAC

LDGMSENGMNALCYAAAAGHMKLVCLLIKKGAR - UNI1206 - VDHLDKKGQCALVHSALRGHSDILQYLLNCEWSAGPPQPGTLRKSQALQQALTA

AASMGHSS - UNI5713 - VVQSLLGMAEEHEIEVNGTDTLWGETA - UNI9955 - ALTAAAGRGKVEICELLLERGAAVSRANRRGVPPLFCAA

RQGHWQ - UNI11853 - VVRLLLDRGCDVNLSDKQGRTPLMVASCEGHLSTVEFLLSKG GAALSSLDKEGLSALSWACLKGHRAVVQYLVEEGAEI

DQTDKNGRTPLDLAAFYGDAET VLYLVEKGAVIEHVDHSGMRPLDRAIGCRNTAVVVTLLRKGAKLG - UNI9883 - GNAAWAMATSKPDILIILL

QKLVEEGNVMYK - UNI10164 - KGKMKEAAQRYQYALRKFPREGLGEDMRPFNELRVSLYLNLSRCRRKTN DFGLAEEFASKALELKPKSYEAFY

ARARAKRNSR RQFLAALADLQEAVKLCPNNQEIKRLLARVEEECKQLQRNQQQKQQGPPPAPANDSDNEEDAPASSLKDHFPIEEAEEEDTSSQEESIS

PTPRSQPPPSVPSPYIRNLQEGLQSKGRSASPQSRAGISKSLRETVAQSGLVMQPTKQAQIVKTNQHLGSGQSSMRNSSTKIQVSSQNPPPSPMPGRVSA

APAVSRNQHLEGTGPFTAGTGCGHFGDRLGASQSLQLQRSESGTAYPLPSKVKAAERLLAHASVAVDMAPPNQGGPVSCSDVRHPASLSSSGSSGSPSSS

IKMSSSTSSLTSSSSVSDGFKVQGPDSRIRDKGTTQVQGGTAEHRPRNTPFMGIMDKTARFQQQSNPPNRSWHCPVAEGLLTNTATAAGLQSNSEKPTLK

PGGYCSQAKPCSVPPLSMGVHNGAQVKELEENKCQIPALCQDNRITKGVPHLYPEGVSKQPLHVSTEAHRSHLTSAKPKRSFIESNV
Transcript ENSMUST00000100082
Sequence
ATGCCGGGTAGAGTATCTGCAGCCCCTGCC ACTGGTTGTGGCCACTTCGGGGATCGGCTGGGCGCCAGCCAGAGCCTCCAGCTGCAGCGCAGTGAGAGC

GGCACTGCGTATCCTCTACCGAGCAAAGTCAAAGCTGCCGAGAGGCTCCTGGCTCATGCCTCCGTGGCCGTGGACATGGCTCCTCCAAACCAGGGCGGAC

CAGTGAGCTGTAGCGATGTGCGGCACCCGGCTTCCCTCTCTAGCTCAGGCTCCTCTGGCTCTCCATCGAGCAGCATAAAGATGTCAAGTTCCACCAGTAG

TTTGACTTCAAGCAGTAGCGTTTCAGACGGATTCAAGGTCCAAGGACCAGACTCTCGGATCAGAGACAAAGGTACAACCCAGGTGCAGGGTGGCACTGCC

GAACACAGGCCCCGCAACACTCCATTTATGGGCATCATGGACAAGACCGCCAGGTTCCAGCAGCAAAGCAATCCTCCGAACCGCTCCTGGCACTGCCCGG

TGGCAGAGGGGCTACTGACAAACACAGCCACTGCAGCTGGCCTGCAGTCTAACTCTGAGAAACCCACTCTCAAGCCAGGAGGATACTGTAGCCAAGCCAA

ACCGTGTTCAGTTCCTCCCCTGAGCATGGGTGTCCACAATGGGGCTCAGGTGAAGGAGCTGGAAGAGAACAAGTGCCAAATCCCAGCCCTCTGTCAAGAT

AACAGGATAACTAAGGGGGTTCCTCATCTCTACCCAGAGGGCGTCTCTAAGCAGCCACTTCATGTCAGTACGGAAGCCCACAGGAGCCACCTCACTTCAG

CAAAACCAAAGCGATCGTTCATAGAGTCCAATGTGTGA
Translation
MPGRVSAAPA TGCGHFGDRLGASQSLQLQRSESGTAYPLPSKVKAAERLLAHASVAVDMAPPNQGGPVSCSDVRHPASLSSSGSSGSPSSSIKMSSSTS

SLTSSSSVSDGFKVQGPDSRIRDKGTTQVQGGTAEHRPRNTPFMGIMDKTARFQQQSNPPNRSWHCPVAEGLLTNTATAAGLQSNSEKPTLKPGGYCSQA

KPCSVPPLSMGVHNGAQVKELEENKCQIPALCQDNRITKGVPHLYPEGVSKQPLHVSTEAHRSHLTSAKPKRSFIESNV

For any suggestions or comments, please send an email to unitrap@crg.es