Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035202 (Lars2)
Chromosomal location
Chr 9: 123276054 - 123371780 (+)
Description
leucyl-tRNA synthetase, mitochondrial Gene [Source:MGI Symbol;Acc:MGI:2142973]
RefSeq_dna
NM_153168 
RefSeq_peptide
NP_694808.1 
UniGene
Mm.276076 
MGI
MGI:2142973 
Uniprot/SWISSPROT
Q8VDC0 
Uniprot/SPTREMBL
A6H6S4 Q14DP3 Q14DS6 Q3V377 Q3V3U1 
Human Ortholog
ENSG00000011376 (LARS2)
Omim not available
UniTrap UNI28332
Vector Insertion
Chr 9: 123276226 - 123280972
Public Clones not available
Private Clones OST33651 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21040
Vector Insertion
Chr 9: 123281222 - 123286818
Public Clones not available
Private Clones OST345095 (lexicon) OST327015 (lexicon) OST195302 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1212
Vector Insertion
Chr 9: 123286948 - 123301900
Public Clones CE0076 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31651
Vector Insertion
Chr 9: 123368738 - 123370616
Public Clones (sanger) IST14435B8 (tigm) IST14265E12 (tigm) IST13019G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038863
Sequence
GTTGTTTTGCCAACATGGCGGCGCCCAGAGTGACTGGCTGGGTCTTGCTCGTGTAATGCTTGGGGAACGAGGCAGAAGGTAGCAGCTGGCCAGACAGAGC

CTGAGCGCAGAAAGCCCCGCCTGGGGCTCAGGAAGACGAGAGACAAGCCCCGCTTAGCCCCCGGAGCTGAAG - UNI28332 - GGTCTTCTCTCCTG

AAGAATGGCATCCACTTGTCAGAGGCTGAGTTTCTATGTCTCTCCTCTGAAAAGGCAGCTAGTTAGCAGGCCACCTGTCATCCTGTGGGAAAGACTAATT

CCAGGGTGTTCCAGAAGTATCTACAGTGCCACCGGGAAGTGGACAAAGGAGTACACACTGCAGACAAGGAAGGATGTGGAGAAGTGGTGGCACCAACAGA

TAAAGGAGCAAGCGTCCAGAGTCTCAGAGGAAGAT - UNI21040 - AAATTAAAGCCCAAATTCTACTTGCTCTCCATGTTCCCATACCCTTCTGGC

AAGCTGCACATGGGCCATGTCCGTGTCTACACCCTCAGCGACACCATTGCACGGTTCCAGAAAATGAGAGGCATGCAG - UNI1212 - GTTATCAAC

CCCATGGGGTGGGATGCATTTGGATTGCCTGCTGAAAATGCTGCCATAGAGAGGAATTTGCACCCTGAAAGCTGGACCCAAAG CAATATTAAACACATG

AGGAAGCAGCTCGACCGCCTCGGCCTGTGCTTCAGCTGGGACAGG GAAATCACTACATGTTTGCCAGATTACTACAAATGGACTCAATACCTGTTTATC

AAACTCTATGAAGCAGGACTGGCCTATCAAAAGGAG GCCTTGGTTAACTGGGATCCAGTGGATCAAACAGTGCTAGCCAATGAGCAGGTGAATGAATAT

GGCTGTTCATGGCGTTCTGGAGCCAAGGTAGAGAAGAAATACCTCCGACAGTGGTTCATTAAGACAACTGCTTATGCAAAG GCCATGCAGGATGCGTTG

GCAGACCTCCCAGAGTGGTACGGAATCAAAGGCATGCAGGCCCACTGGATTGGGGACTGTGTAGGCTGTCACCTGGACTTCACATTAAAG GTTGATGGA

GAAGACACAGGAGAGAAATTGACAGCATACACAGCCACCCCTGAGGCCATCTATGGCATCTCCCACGTGGCCATCTCTCCTAGCCACGGGCTTCTACATG

GCTGCAGCTCTGTGAAGAAAGCCTTGCAGAAGGCACTAGTCCCTGGCAGAG ATTGCCTCACACCAGTGATGGCTGTGAGCATGCTCACCCTGCAGGAGG

TCCCCATCGTTATCATGGCTAACCCTGACTTGGAAGGCTCTCTAGATTCAAAAATAG GAATCCCCAGCACCAGCTCAGAGGACACCAGACTGGCCCAAG

CTCTGGGCCTACCCTACTCTGAGGTCATTGAAGCTTCACCCGATGGCACAGAGAGACTGAGTGGATCTGCTGAG TTTACAGGTATGACCAGGCAGGATG

CCTTTGTAGCCCTGACTCGGAAAGCCCGTGGGATGAGAGTGGGTGGACACGTGACAAGTAACAAGCTGAAGGACTGGCTGATCTCACGGCAGCGCTACTG

GGGCACACCGATCCCCATTGTCCACTGCCCAGCCTGTGGCCCTGTGCCTGTGCCACTGCAAGACTTGCCTGTGATTTTGCCCAGCATTGCATCTTTAACG

GGCAGAGGAGGCTCCCCGCTGGCCACGGCTTTGGAGTGGGTGAACTGCTCCTGCCCAAG GTGCAAGGGATCAGCAAAGAGAGAGACGGACACCATGGAC

ACCTTTGTGGATTCTGCGTGGTACTACTTCAGATACACTGACCCTCATAATACTCAAAG TCCTTTTGGCTCGGCACTGGCAGACTTCTGGATGCCCGTG

GATCTGTACATCGGAGGAAAGGAACATGCTGTCATGCACTTGTTCTATGCACGATTCCTCAGTCATTTTTGCCACGACCAAAAGATGGTGAAGCACAG G

GAACCTTTCCATAAACTACTGGCCCAAGGCCTCATTAAGGGACAGACATTCCGCCTTCCATCTGGACAGTGTCTGAAGAAGGAGGATATAGATTTCACAG

 GTCCTGCTCCTGTTTGTGCAAAAACAAAAGAGAAGTTAGAGGTGACGTGGGAGAAGATGAGCAAGTCCAAACACAATGGGGTGGACCCTGAGGAGATTG

TGGCCCAATATGGAATTGACACAATCCGGCTCTACATCCTCTTTGCAGCCCCTCCTGAGAAGGACATCTTGTGGGATGTAAAGA CTGACGCACTCCCTG

GAGTGCTAAGATGGCAACAGCGGTTGTGGTCCCTGACAACAAGATTCATCGAGGCAAGGACTTCCGGGACAGTCCCTCAGCCTCAGCTGCTGAACAGCAA

GGAGAAAACCAAGGCCCAAAACCTCTGGGAGTACAAAAATGCAGTCATAGCTCAG GTGACCACTCATTTCACAGAGGACTTTGCCCTGAATTCTGTAGT

TTCTCAGCTGATGGGACTCAGCAGTGCCCTCTCG CAAGCCTCTCAGAGAGTGGTTCTCCACAGCCCTGAGTTTGAAGATGCTCTGTGTGCCCTGCTGGT

GATGGCTGCTCCCCTGGCCCCTCATGTAACCTCAGAACTTTGGGCAG GCCTGACGCTGGTACCAAGCAAGCTCTGTGACCATTATGCCTGGGATTCTGG

TGTGATGCTTCAGGCCTGGCCCACTGTGGACTCACAGTTCCTTCAGAAACCTGACATGGTGCAGATGGCTGTTCTG - UNI31651 - ATCAACAACA

AGGCCTGTGGCAAGATCCCTGTGCCCCAGCATGTTGCCCAGGACCAGGACAAAGTCCATGAACTTGTTCTCCAGAGCGAGCTAGGCATGAAGCTGCTGCA

GGGGAGAAGCATCAAGAAGGCCTTCCTCTCCCCCAGGACTGCCCTCATCAACTTCTTGGTGCAGGAGTGACCAGGGCTTCTAGGACCCTCCTTCTCTGCC

CAGATCAAGGGAAGGAATGTTAACGTGGGAAAAAAGGCAAACATCAGGGACATTGGCCTTTGTGCCAGGACCAGCAGGAGTCAGCAGGAGGCCTAAGGCG

AGCTCAGGGAGGACAGAAACCTCCCGTGGAGCAGAAGGGCAAAAGCTCGCTTGATCTTGATTTTCAGTAGGAATACAGACCGTGAAAGCGGGGCCTCACG

ATCCTTCTGACCTTTTGGGTTTTAAGCAGGATGTGTCAGAAAAGTTACCACAGGGATAACTGGCTTGTGGCGGCCAAGCGTTCATAGCGACGTCGCTTTT

TGATCCTTCGATGTCGGCTCTTCCTATCATTGTGAAGCAGAATTCACCAAGCGTTGGATTGTTCACCCACTAATAGGGAACGTGAGCTGGGATTAGACCG

TCGTGAGACAGGTTAGTTTTACCCTACTGATGATGTGTTGTTGCCATGGTAATCCTGCTCAGTACGAGAGGAACCGCAGCTAGCTTGTGTCTCCAGTGTC

TTTTACCATCACAGGCCCTGGCTCTGTGCTACCTCCCTAGAATACCTGTGGTTCATCACCTTCAGCTCACACTCCATTCAGACAATGCTCACTTAGGCCT

ACAAGCAAGGGAGAGGCTTAAGCACAAGGTCTTTAAGCTTGATACTGTGCCTGGTCTCAATGCCTAGAAATTCCAACTTAACTGTCGCTATCATAAAGGA

TTTTAAATTTTTTTACAAGTGAGAACCTAGCATGTCAAGGTCCTAGGTTCCATCTCCAACACGAAAAAAGCAAGGCAACTCTACCAAAGAAACTAATTAC

ATACTTGTATTCCCAATATGTGAGAAGCTGAGGAAGGAGGATCATGAGTTTAAAGCCATCCTTGGTTACATGAGACTCTTGTCTCAAAGAACTACCAGGG

ATCCTAATGGACAACAAAGGTTGAAAACCATTGAATTAATAAATGTTGTGAACC
Translation
 - UNI28332 - MASTCQRLSFYVSPLKRQLVSRPPVILWERLIPGCSRSIYSATGKWTKEYTLQTRKDVEKWWHQQIKEQASRVSEED - UNI210

40 - KLKPKFYLLSMFPYPSGKLHMGHVRVYTLSDTIARFQKMRGMQ - UNI1212 - VINPMGWDAFGLPAENAAIERNLHPESWTQS SNIKHMR

KQLDRLGLCFSWDR EITTCLPDYYKWTQYLFIKLYEAGLAYQKE ALVNWDPVDQTVLANEQVNEYGCSWRSGAKVEKKYLRQWFIKTTAYAK AMQDA

LADLPEWYGIKGMQAHWIGDCVGCHLDFTLK VDGEDTGEKLTAYTATPEAIYGISHVAISPSHGLLHGCSSVKKALQKALVPGRD DCLTPVMAVSMLT

LQEVPIVIMANPDLEGSLDSKIG GIPSTSSEDTRLAQALGLPYSEVIEASPDGTERLSGSAE FTGMTRQDAFVALTRKARGMRVGGHVTSNKLKDWLI

SRQRYWGTPIPIVHCPACGPVPVPLQDLPVILPSIASLTGRGGSPLATALEWVNCSCPR RCKGSAKRETDTMDTFVDSAWYYFRYTDPHNTQS SPFGS

ALADFWMPVDLYIGGKEHAVMHLFYARFLSHFCHDQKMVKHR REPFHKLLAQGLIKGQTFRLPSGQCLKKEDIDFTG GPAPVCAKTKEKLEVTWEKMS

KSKHNGVDPEEIVAQYGIDTIRLYILFAAPPEKDILWDVKT TDALPGVLRWQQRLWSLTTRFIEARTSGTVPQPQLLNSKEKTKAQNLWEYKNAVIAQ 

VTTHFTEDFALNSVVSQLMGLSSALS QASQRVVLHSPEFEDALCALLVMAAPLAPHVTSELWAG GLTLVPSKLCDHYAWDSGVMLQAWPTVDSQFLQK

PDMVQMAVL - UNI31651 - INNKACGKIPVPQHVAQDQDKVHELVLQSELGMKLLQGRSIKKAFLSPRTALINFLVQE

For any suggestions or comments, please send an email to unitrap@crg.es