Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035236 (A930041I02Rik)
Chromosomal location
Chr 2: 38921734 - 39046250 (-)
Description
RIKEN cDNA A930041I02 gene Gene [Source:MGI Symbol;Acc:MGI:2443716]
RefSeq_dna
NM_178778 
RefSeq_peptide
NP_848893.2 
UniGene
Mm.204836 
MGI
MGI:2443716 
Uniprot/SWISSPROT
Q8C8N2 
Uniprot/SPTREMBL
A3KGQ2 B0R0E3 Q3TQB4 Q8C4E7 
Human Ortholog
ENSG00000173611 (C9orf126)
Omim not available
UniTrap UNI20037
Vector Insertion
Chr 2: 38988607 - 39045508
Public Clones (sanger) IST13600G9 (tigm) IST14252H4 (tigm)
Private Clones OST374570 (lexicon) OST325531 (lexicon) OST257801 (lexicon) OST251779 (lexicon)
OST250171 (lexicon) OST41320 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22416
Vector Insertion
Chr 2: 38963924 - 38976630
Public Clones not available
Private Clones OST297670 (lexicon) OST234310 (lexicon) OST201447 (lexicon) OST41460 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12606
Vector Insertion
Chr 2: 38954996 - 38957840
Public Clones W029F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21292
Vector Insertion
Chr 2: 38939131 - 38950222
Public Clones not available
Private Clones OST335806 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038874
Sequence
TCTCCGCCTACTCCAGCCTCCGCCGCTTCAGCTTCCCGAGCGAGCCCTGCGGCCGCCGGAGCATCTCCCGCGGCGGAGCAGGAGCCGGATGGTCAGAGGA

GCCCGGCAGTCCCAGCAGCCGCGGAGTCGCCTGGCCCCCAG ACTGTCTGGCACAGTGGAGAAACCACCCCGAAAACGGAAAAGCAG - UNI20037 -

 GACTGAATTTACTCTTAAAGAAACTATGTCCTCTGGAGGTGCTGAAGATGACATCCCACAGGGAGAGAGGAAGACAGTTACAGATTTTTGTTATCTTTT

GGATAAATCCAAGCAACTGTTCAATGGCTTAAG AGATTTGCCTCAGTATGGACAGAAGCAGTGGCAGTCCTACTTCGGAAGAACTTTTGATGTTTACAC

CAAACTCTGGAAATTCCAGCAGCAGCATCG ACAAGTCTTGGATAATCGGTATGGCTTGAAGCGGTGGCAAATAGGGGAAATCGCTTCCAAGATCGGGCA

GCTGTATTACCACTATTA TTTACGAACTTCTGAGACCAGTTATCTGAATGAGGCTTTCTCCTTCTACTCTGCAATCAGACAGAGATCATACTACTCTCA

AGTCAATAAAGAGGACAG - UNI22416 - GCCTGAGTTGGTTGTTAAGAAACTCCGATACTACGCAAGATTTATAGTAGTTTGCCTTCTTCTTAACA

AAATGGACGTTGTGAAAGACCTGGTAAAG GAATTGTCTGATGAAATTGAAGATTATACTCATCGCTTTAATACTGAAGATCAAGTCGAGTGGAACCTGG

TGCTTCAAGAGGTAGCAGCATTCATTGAG GCAGACCCTGTGATGGTGTTAAATGATGATAACACTATTGTTATCACATCCAATCGCCTCGCTGAGACAG

GAGCCCCCTTGCTGGAGCAAGGCATGATTGTGGGACAGTTGTCTCTGGCTGATGCACTCATTATTGGTAATTGTAATAATCAG GTCAAATTCAGCGAAT

TAACTGTTGACATGTTCCGGATGTTGCAAGCCTTGGAGAGGGAGCCTATGAATTTAGCTTCCCAGATGAATAAGCCAGGAATACAG GAGCCAGCTGACA

AGCCCACCAGACGAGAAAACCCCCACAAGTATCTACTCTACAAACCGACTTTCAGCCAACTGTATACATTTTTAGCAGCATCTTTTAAG GAGCTGCCTG

CCAATAGTGTGCTTCTGATTTACCTGTCAGCCACTGGCGTTTTCCCCACAGGTCGTTCTGATGGTGAAG - UNI12606 - GTCCTTATGACTTTGGA

GGTGTACTTACTAATAGTAACCGGGACATTATCAATGGAGATGCTATCCACAAGCGAAATCAGTCTCACAAGGAAATGCACTG CCTTCATCCTGGAGAT

CTCTATCCATTCACAAGGAAACCCCTGTTCATCGTTGTGGACTCCTCCAATAGTGTTGCCTACAAG - UNI21292 - AATTTTACAAATTTGTTTGG

ACAGCCACTCGTCTGCCTTCTTTCTCCCACGGCATATCCAAAAGCTTTGCAAG ATCAGTCTCAGCGAGGTAGCCTCTTCACGCTCTTTTTGAACAATCC

TCTAATGGCCTTCCTATTTGTGTCTGGATTGTCAAGCATGCGTAGAGGCCTGTGGGAAAAGTGTCAAGAATATCTTCGAAAAATCAACCGTGATATTGCC

CAGCTACTGACCCATTCACGTTCAATAG ATCAGGCCTTCCTCCAGTTTTTTGGAGATGAATTTCTTCGATTGCTTCTCACAAGGTTTGTCTTCTGTTCA

GCCACCATGAGGATGCACAAGGCCTTTCGG GAAACGCGAAATTACCCAGAATCCTATCCACAACTGCCAAGGGATGAAACCGTAGAGAATCCTCACCTT

CAGAAGCACATTTTGGAATTGGCCTCCATTCTGGATGTTCGAAACATCTTCTTTGAGAATTCTATGGATGACTATTAAAACCCTCTTGTTTAACAGTTTT

TCATTTTCCACAGATTTTAAATGGTGCAATTTTTTAATGTAATGACATAGTGTGTTACTTGGTTTTTATTTTTGGATTTAGGAAACACCATTTTAAAAGC

AAACTGAAAAAAGTTCAAACTTTTAGGGTAACTTTTAAAATATAATCTTTCAAGTCTTTTAAATTCTCAATCTTGAAATTTTTATTTTTTTGGTCTTGGC

ATTAGATACTTACCTCCAACATCTACCCCCACATTCAAATAGTTACTGTTGTCACCTTAAGAAGAACATATATTGTTTATTTTTCCATAATGAGGACAAT

CCATAAGTTAAACTTGGACCTGGAAGTGTCTGGATTTGGGAAATACCTAATTGTTCATAGAGGTGAAACTGGCCACATGAAAGTCAAGAGCAGAGCCCTT

CTGTGGAGTTGCTTTTCACTTCACACTAATCGGTAGGACATAAGTTACTCTCTGATGTACAAACTGATGTCTTGAGATCTCTGAATTTCATTAAATGATG

TTAAATTTTTAGAACCTATTTAGAATTGTTTGCATCTGGAAATTAAATTTTAAATAGGAACTTTAAGATGACAGATATTTAGAATATGAGTACTATTATG

ATTTGTTTGCATATTTACTTTTCTTTGTGGTCTATGAATGCTAAAAATGCAAAGGAAAATACTTTTAAGTATTTCAGCCAAAAATCAAGTCATTGGTTTC

ATAGTTGGATCTCTACACAGATTCTTCGTTGGTTGGTTTTAAACAGTGTTGTAATGGATTCCTTGGTATATCCGCTGCACAGTTTTTCTAATCTTTTTTC

ATATTCAAGTTTCCAAGGCATGGATGTTAGAGAGACTCTGTGTGAGTTGAGGATAACTGGGTGTTAAGGAAGTAAATCGTGAGTTAATTTTGCTTTAACA

ATTTGGAAGATATTAAAACTCCCTGTGTTTTGTTATTTTATATTCATGCACAAGTTTTGTTATTTTAAATAGGACTCAATATGTAATATAAACGTTTTGT

ACATCCTTCCCTCCATCTCCTTGGTAATCTCAAAGGTCCTAGCTGTGAAGGTTCTTCCTTCCTGGCATCTTTTGGTTGCATGGCATTTAAATTCAGAAAT

CTGTGAATTGTAGGGTCTTCTGCCTGTGTCTACCCCTGACAGTCCTAGAGAAATGAGGTGGTTGTTTTCAGTACCTCTTTCCTGTGGCCCTAAGGAAATT

TTTGATATGGTATTTTAACCCAGTTAACTCTCACTAGAGCATCACGTGGGTGTAAGTTGTGGCCATATCTGCTCCAGTGCACTTACTTTGTGAAGTCCAG

GTCATGGTTGGGTCAGGGACTTAGGAAGTTTCATTTGCTTTTAAAATTGTTTGTATGTTCTTTCAGACAGTATTTTTAAAAGCTTAGAAAAAGGTTAATC

TGGAAAGAGCCCTTCCAGATAGAGGTTTTTCCTTTTTAAAAGGCCTACTTCCATTTGTTTGCAAATCATGATTTTCCTTTTATAAACTTTCCTCCTGGAA

TGTAGCAGTAAATATTCCTTAGTAGTCTGGCCTCTGTTCCAGTTCCCTTAAGTACTGACCAACAATGCATACTTTCCTGTTCCCTGACATCTAAAGTGGC

CTTGACCAGTGTTTTATTCTTTTTTGCTAAGCCTAAGGACCAGTTGTTTCAAAAGCAAGAGGTCTGAGTTCTAATCCTGGCTTTTCTAGTAATGAGCATG

ATATCCTTTGACAGACAAATAATCTGTTTTTTAGCACTCTTCCATATAAAATAGAGCGACTCGGTTAAGATCCTATTCCTGTTTGTGATTCTACAGTTTG

GAACATTTGTTCCAAAAGTGTTGATTTCCTCCCCATTGCTTCCAAAAAAGTTGATTTGTGTGGTTTTAGCACTATAATATCCTTTCTATATCGTGTTTAC

TAAGGTGGTTCAAAACAAACCAAAAAATCCTAGGTCATACTTTGCTGTTTTGAGACTTGCTTAAAGAGACTTTCCTGGAGAAATTAGACCTTCCATGGTC

AGAAAAAAAATGTATGTTGCAGATGCCAGTGTAAAACTAGATTATAACATGGGTTCTTAAACTAATAGAAATACAGTTCCTAACTCGTGGTTAAAGATAT

AAAATGGACCAAAGCTGTGGTTGTAGCTTCTTGGTAGAGCATTTAGCTAGTATTCAGAAATCCTGTGTTTGGTCTTCATCACTAGGGGAAAAAAATATAT

TTTTAAGAAAGAAAACAATAGAACCAATTTTGAGCTGGGTATGGTGGTGCATGCCTTTAATCCCAGTGCATAAGAGGCTAAGGCAGGAAGGTTGCAAGGT

CAGAGCTAATCTAGATTATATAGCAAAAGTCCACCTCAAAAACAATTGTTAAGAGATCTGAAATCTTTTGAAAGCAAAACTGGAGTAGGGAATTTGAAAC

TTTAAAAAAAAAATCTTTGCCTTAAAAAATAAAAACAAACATACGTCACACATACCACATTATTTTTTTAATGGCATTGAAATGTAAGCAGAGGAGACTT

AAAAATCTTTGCCTTGAGGATTAAGATCGGGCTTAGTATTAGAACCTTGCCTAGCATGCGTATATCCCTGGTTTCCATCCCTGGTACTTAGAGGTATAGC

AAGAGCATCAGGAGTTCAAGGCCATCCTTAGCTATACAGAGTAAGCTCTAGACCAGCCTGCACTACAGTATGAGACCCTTTTGCAAAAATAGATTTGCCT

ATTTTAAGCTCCATTTAATCTTAGAATTTTTAAAAACTTAAATAGTAAGACTAAAAAAAGCAAAGCCAAGGGAGCAACATTTTTGTACTCAAATTGCACA

AATTTCTCTGTAGATTCTGATAAAGTTTCTGGTGTCTTAAGAATCACTATAAACAAACTAGGAAGAATCAGACTGTAAGAGACTGGTTATGCACAAAGCA

AAGTGAAGCACAACAGGATTTTCTTTCTGTATCCATGTATTTCTGATACTAAACCTTCCCTGTCTTATAGGAAGCAAGCTGAGATGTCAGAAGCTACTGG

TTATTTGGTGATAGACATAACAAACACGAGCTCATCTCAGCCCAGTTGCTTAAACTTCTTTCTGTAATAAACAGGAGGGAAATTTTTAGAGCTGTATAAT

CTTAACATAAAAATTAGGATTTTGTTCTGTTTTGGAAATTCAAACCAGTCAAGATAAGGCTCAGTCATAGAGTGCTTGCCTAGCATCTGCAAGGCTCTGT

GGTTAAATCCCAGTATAATGAATATTCTCGCCAGTGAATCAGCCACCACTAGCATTTTTTATTAATTATAAAATCAGATTTTTTTTCTTTGATTTTAGGC

AGTATATATTCTTTGTAAGTATATCCCTCCTAGGAAGCGGTGCTCTCAAAAACTTTCAAAGCACAGAATTTATTGTGCCCTTTATACTTTTTAACAAAGT

TAAAATGTTTCACAGTTTGGGAATTGAAGTGTAATTTGTTATTTGAGGTTTTCCTGACTCGAGGTCTGGGTTTAGAGTTTGGTTTTGTTTCTTCTCCTCC

ATCATGTAATAGAATTCCCTTAAATAGGTAATGATACTGAATTTCATTAGTGTCAAGGAAGAAGTCCAGCTCAGACTTCCGAATCAGACACAGGTCCTTC

TGAAGCATTCTTCTCCAAGTTCAGTCTCTGTCTATGTCTGAGGTGGGGTTTCAACCTAGTTGAAAAGTCTCACTTATCCGTGGAGACTTATAATCACCTC

AATAACAAGAGAATGTTCTGGACTGGAGATGCATTAAGGTGCCAATGTCTGCATACTTGGCCACTGCCAGAATCATCCGTCCACTCGGTGTGAGTGGAAG

GCTTAATATGAATATGAATTTGAATGCCTTGAGTCTCCTGGAGATTTGGGAGTATTTTCTGTTCTCATGTTTATTTGGAGAAGTTTAAGAGTGTTTAGGT

TGAAGGCTCTTTTTAGAACTTATTTATTTGAAATTCTTATTTTAATGGCATGTGTATATTTTTGTGATGCTATATGAAATCTCTGTAAACTTTTTGTATA

TATGTGTACATATTTTTAAATATCTTGGTATGCAGTGATGCAGTGTGTGCATATTATATACCTATACCCATTGTGGGCTGATTTATTTTAGTTCTGTGAG

GACATCAGAGTGGCATTGTTCATGCTACTATAATTAGGTTGTGGCTGGATATCCTTCACAAGCCTCAATTTTAAGGGGCTTGTGCTGAGATAAAATGGGC

TCCTTTGGAGTTGAAATTAAGATATGAAGATACTAAGAGTAGGCTGCATATTCTCAGCTTTAAAGTCATCTACAAACTTCCATTTAAATTGATATATTTG

CTAGAAACCTGAAAAACTATGATTGTGAATCTGAGACACCAGCAGTGTCTTACTTAATCTATTAGTTCTTTATTTTTCTTAGCCCATATTTGAGTGTTAG

TACTGAGTAGGACTTTGAGGGCTATTGAAAAAAATTACTTTGCTCTCACTTGAAAATAGAAAATGTCTTTTAAGTTGAAATAGCCATGTTTATCATTATA

ATATCTGATGCTAAATTTTAATTTCTGAGTTTTTTTCCATCAGTCTGCTCATTCTATAAGTGTCTCTGTGAGGCAGAAGGGACATTAGCAAAAAAAGGCC

AAACCTCAGTGGGCTGGATAGAGGGGAACTGGGTTGTTGATGTGTGTGTGTCTACAGCAGCTGTCTGGCTAAGTAAACTTTTCTTGCTGGCATTGCATAT

CAAAGATAAGTCCATTCATCTGAAAAATGCTTCCAGCAAATTCAGAGCCTTTACTTTTATTGCTGAGTTCCCTGGGAATACTTTTACTGTACAATTTAAC

CATACATTCACACACAAAGTAGATTTCTTAATATGAAGTGCCTAAGAGGCTATAAAATCCTAGGCTTCTAGCTGAGCACAATGTGTGGGGCAGGGAGGGT

ATCTATAATCCCAGTTCTTAGGAGGGGGAGTTAGAAGTTTGAGGCCAGCTTCTGGTGCATAGTAAGTTTCAGATTAGCATGGGCCACAGGAAACCCTGGC

TCAAAAATCCTAATAGACTTGGGATGATAATGTTGGAGACAGTAAAATTACAGAAAATATGTACGGTGCCAATTTGTCTGGGTTTTGCAGCATATCAATA

TTTTTAGTTCATGTGCTTATTTGCATGAATGAATGTAAGGGATATTTAGACACTTGGATAACTTTACTATAAAGAATAAAGTTATTTCTGCATTGTAAAA

TAACTCCAGGGCAACTTTCTACTGTATTCTTCCAAAGACCAAATCTCTCTTATTACTTTTTCCAAAGAGAAAAATCAGTTTGAGTCAATTTTACCACTTC

TAAAATTATTGCATTTGCCCCTACCCCATTGTTAATAAAACATCCAGCTATTCATAACACTTTTCAATTATACTCTTAAGGTTATCTTTTTCCTGAAATA

AATTAAGGTACATTAATGTGATTTTTTTTTTCCTGAGAAATCCTATCAAAAAATGTTCACAGACTCTAATGTTGTTTTAACAACCAAACTTTTTTGAAGA

AGGCAGATCATATATTATGTTTAAAATTCATAAAACTGGGGCTGGAGAGAGGTCTGGGCAGTTAATAAGAACCTCTTTGTGTTTTGCTTATCTGAGACAG

GATCTCTTTATGTAGCCCTGGCTGTCCTGGAGCTTCCTATATAGAACAGGCTGAACTCACAGAGATCCTCCTACCTCCACTTTCTGAGTCATGGACCACC

CACCACGCCTAGGTTTAATTCCTAGCACACACACAGCTGCTCACAACCTTCAGTTCCAGAGCATCTGATACATTCTTCTGGCCTCTGTGGGCACTACATG

CATGTGCACTGCCTGCATGTGAGGCATAGGCATATAATACACCTATGTGTTTATTTTCTTTTAAAAAAAAAAAAAAACCTAGTAGGGCAAAGTTGCTACT

GTGCCTGTAACTTCTCCCCAAACAGTAACAAAGCTGGTAACTTTGCAGTTCAGCAAAATATGAATTGCTGGGACAACCACGCCTTTCCCCCACATTCTCC

TGAATGCTTATGCACACATAGTCAACTCCTAGTCTTTCCTCAACACTGGATACTACATGAGTTAATAAAAGTAAGATGATTCATCTTCCTCAAACTAGGC

CTTCCATCCTCACTGAGTTCTGAGCACAAGAATGTAATTTTCAACATGCATTATATTAAATGGAGAATAATTTATGTGACGATGGAATCAATCACCTACT

TACAGGAAAGGAATAACATAGAAGAATATACAATTAGGTAAGGATAAATGCATTAAGTATAACTAATTTGGTACCATACAAGTATTTTCTTTGGAATTTT

GTATGTTTTCTTAAGTGAAAATCAAGAGTTTCATTTTTACACAATACTGTTATTCATAACTATAACATCATTTCATAATTTTAAAATATTTTTCTTTTTG

TGCTTTTCAAATTTAAGTTTGCAGACTACTCAAAGCAGTGGTTTTGAGGGTGTTTTGTTGTTGTTGTTGTTTGTTTTGTTTTGTTTATAATATTGGCAGT

AGATTCCGTTTTAAAAACAGTTTAAAGTATATTACATCGCATTTGACAGATTTGCTTACAGGCTCAGTCTGGATTTGGTCACAAAACAATCTACAAATTG

CAAATATTTTTCCTTTTAAGTGGACAATTCTAGTCTGTCACCTAAGACAATCACCTTTTTATATGTAGTATTTGTGGCAATATCACTAATTTCAAATTTT

ACTTTTTTCAGATCCTAGATTTAACTTTCTAAATTTTCATTCTTATGAAATGAAAATTAATGAACTGAGTTACATCACTTTCAAATTGAAGAGAGGAGTT

ATGGTTAGTTTTTTTTTTATAAGTTTGAAGTGAAAGGTAACTAAATTTTTATACTTTTGTATATATCACTGTTTTTCCCCCTTGTTTAAAACTGTCATGA

ATGTCCATTTTTCCCTGGTTCAAAAGTTGATTTATAAACATTAGTTTGAACTATGAATTTTTCATAGCATGAAAATTCCAAGCATGAAACTAGCATTAGT

AACCATTATAAAATGTCAAATGATGTTATCCCTTTCCCTGGTAAACATTTCCAAACCACAGAGAAAGGCCACTGATTTTTTTTCCCCTAAATTAAAAGAT

ACAGTGGTGTATTTTAAAGTCTTTATGGGAAAAAAAACTACTTATAAGTTCTGTTACCGTTTCCTAAGGAATGGGTTTGTTTTTTAAGAGTTATTATATC

GTTAAATTACATTGTGTTGTTCAACACAGTAATTTAGAACTTGATTTATGTGGCCATTTGTAGTTGCATAGAAATACTCTTTTTACCGCATAGACTATAA

TCGCTAGTTTTCCAAACTTTTTTTTTATAAGCCTTGCTCTTCAGCTCGAGTCCTGTATGTTGTAGGATTCTTAAAATTGAGGCAGGAAGGTCTTACAGAG

TAGGAAATGCTTATAGAGATTACAAGAGAAGGAATTTCCCCAAAAAAGTTACCCTCATTTTGTAGCACCAATATAAGTAGTAGTTGCATTTGTCACTGAA

TCAGATGAAGTAGTTAGAAGTCATATATTTTTACTTTGCTGTAAAGATTAGTATAACTAATTTAAGAGAACTTTGTTATTTTCTGAGCAGTTTCCATTTT

AAGACTTAGTGTCAATTAGCTTTATTCAAAGTATCACTAAAAGTTAATTAAATCAAGGGTTTTGGGTGGTTTTTTTTTTAAAAAGTTCTGTTGATCTTCT

TTTACCCTGAAACTAATGGTGAATCTGTTGTCTACACTATGTTAGGCAGAAATGCACTTGTTGAAATAGCAGAAACTATACTTGACTTTCTAATAGTGTG

AAACACTTTTTTTTTAAATGTGCTTGTCTGTAACTGAAATGTTATAGAATTGTAACCCTGTAGGGATTATAGAGTTATATTTATTAGCTCTCAACAGATT

GAAGCACAACAGTTCTCATGTAACAATCCTTATTCAAGTGCTCTCTGTCGTACAAATAAAGCTGATTGCCTATCTAGTTGTTCACACATCACTATTATCC

TGTATGAGACAGTCTTGTTCATTTGTATTAAAATTTGGGTATTGTGAGTTAATACTTTCAAATAAACCTGTCAGTCAGCTCTGATATGCAGTAGATTGTT

TAGATTCACAAATTTTATGTGTTACTGGTCAATTTTGAAGAGACTTTACCACAGTGACTAAGGGGAAAATTCTATTGTATCATTTGACTTGAACATTTGT

AAAAGTCTTGTCTGTGGTGTTTCTAAATTGCTTAAACCATACATTCTCTTAAGGATTTTAATTTGCTTTTGTTCTTTTCCAACAGTCATTTTCTGGTTTT

GTCTGTTACAGTAAACATTTTATAGACCTTAGGAATTGTCAAGTTCTTGAACATTTATTTTCTTGAGTTGATCACTTAACTCTTGTGTATGTGATTTGTC

ATAAACAATTAGAGCCTTTCACTTCTTCACTACATGAATTTCAGAGTAAACACTGTGATTCTACAGAGCAGATTCCATAGGCGTTCCAATATTCTTAACT

GTTACACAGTGCCTGTCACTTTGAGGGCACATAAATACTAGGATGGAAAATAAAACGTTGTTTTGATGTTTGTTAAATAACAAGATTACAGAATATCTGT

GGGGTTTTTTTTGTTTTTTGTGGTCAGTGTAATAAAGAATTTTGCATTGATAAATATTCTCTAGGAATGTGTATACATTCATCTAGTGTGAACTCTTGTA

AATGAATTTTGTATCTTGAATCACGTATATATTAAGTGTATCATCAATATAAAAATAAACATTATTTGCTTAAA
Translation
MVRGARQSQQPRSRLAPR RLSGTVEKPPRKRKSR - UNI20037 - RTEFTLKETMSSGGAEDDIPQGERKTVTDFCYLLDKSKQLFNGLR RDLPQ

YGQKQWQSYFGRTFDVYTKLWKFQQQHR RQVLDNRYGLKRWQIGEIASKIGQLYYHYY YLRTSETSYLNEAFSFYSAIRQRSYYSQVNKEDR - UNI

22416 - RPELVVKKLRYYARFIVVCLLLNKMDVVKDLVK ELSDEIEDYTHRFNTEDQVEWNLVLQEVAAFIE ADPVMVLNDDNTIVITSNRLAETG

APLLEQGMIVGQLSLADALIIGNCNNQ VKFSELTVDMFRMLQALEREPMNLASQMNKPGIQ EPADKPTRRENPHKYLLYKPTFSQLYTFLAASFK EL

PANSVLLIYLSATGVFPTGRSDGEG - UNI12606 - GPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHC CLHPGDLYPFTRKPLFIVVDSSNSVA

YK - UNI21292 - NFTNLFGQPLVCLLSPTAYPKALQD DQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSI

D DQAFLQFFGDEFLRLLLTRFVFCSATMRMHKAFR ETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNIFFENSMDDY

For any suggestions or comments, please send an email to unitrap@crg.es