Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035246 (Pcyt1b)
Chromosomal location
Chr X: 90900202 - 90995287 (+)
Description
phosphate cytidylyltransferase 1, choline, beta isoform Gene [Source:MGI (curated);Acc:Pcyt1b-003]
RefSeq_dna
NM_211138 NM_177546 
RefSeq_peptide
NP_997593.1 NP_808214.1 
UniGene
Mm.166467 
MGI
MGI:2147987 
Uniprot/SWISSPROT
Q811Q9 
Uniprot/SPTREMBL
A2A450 A2A451 
Human Ortholog
ENSG00000102230 (PCYT1B)
Omim not available
UniTrap UNI15375
Vector Insertion
Chr X: 90900556 - 90920450
Public Clones 5SD064F06 (ggtc) 5SD064G06 (ggtc) 3SD064G06 (ggtc) PST8032-NR (escells)
IST14016G1 (tigm) IST10916A5 (tigm) IST11977D8 (tigm) IST11542E5 (tigm)
IST12094E9 (tigm) IST14318F5 (tigm) IST12276E1 (tigm) IST10335H2 (tigm)
IST11164G2 (tigm) IST13074G5 (tigm) IST14574D1 (tigm) IST14913F9 (tigm)
IST11095D6 (tigm) IST12506H9 (tigm) IST12991E1 (tigm) IST12041E10 (tigm)
IST13578G5 (tigm) IST13680E9 (tigm) IST12276D1 (tigm) IST13342D3 (tigm)
IST12663G12 (tigm) IST11961D2 (tigm) IST12276G1 (tigm) IST14505B5 (tigm)
IST13390G2 (tigm) IST13330E10 (tigm) IST13354F3 (tigm) IST12938E10 (tigm)
IST12897B7 (tigm) IST12546H1 (tigm) IST13773D12 (tigm) IST12448D11 (tigm)
IST13723E12 (tigm) IST13502A4 (tigm) IST10335E3 (tigm) IST13700F4 (tigm)
IST12717D9 (tigm) IST10608F7 (tigm) IST14298F7 (tigm) IST10083B1 (tigm)
IST14829C12 (tigm) IST14787G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2783
Vector Insertion
Chr X: 90920816 - 90947423
Public Clones AJ0235 (sanger) IST12780C7 (tigm) IST14165C6 (tigm) IST10005G1 (tigm)
IST12493A5 (tigm)
Private Clones OST437725 (lexicon) OST435071 (lexicon) OST433309 (lexicon) OST404153 (lexicon)
OST369925 (lexicon) OST347261 (lexicon) OST339728 (lexicon) OST306499 (lexicon)
OST291118 (lexicon) OST199974 (lexicon) OST199085 (lexicon) OST183896 (lexicon)
OST149111 (lexicon) OST145538 (lexicon) OST125620 (lexicon) OST105517 (lexicon)
OST45604 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17430
Vector Insertion
Chr X: 90947524 - 90951896
Public Clones not available
Private Clones OST443097 (lexicon) OST429931 (lexicon) OST408462 (lexicon) OST329408 (lexicon)
OST285103 (lexicon) OST230376 (lexicon) OST88724 (lexicon) OST23985 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25103
Vector Insertion
Chr X: 90952014 - 90963123
Public Clones IST14421H8 (tigm)
Private Clones OST195142 (lexicon) OST193803 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16946
Vector Insertion
Chr X: 90963276 - 90965517
Public Clones not available
Private Clones OST452055 (lexicon) OST127076 (lexicon) OST110810 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6197
Vector Insertion
Chr X: 90965597 - 90977015
Public Clones CSG217 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7499
Vector Insertion
Chr X: 90977159 - 90980103
Public Clones RRR055 (baygenomics) RRR606 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045898
Sequence
GTGCTGTCTGGTTGTTATAGTGATAAACTGAGGCCCTGCCTCTGGGCTTCTCCGAGAAAGAAAAGGGTGGTGTGTGCGTTGGGGGTGGGGGTGGGGGTAA

CCTCTTTACTTCCCCCCAGGGAAGACAAAAAAGAAGGGAAGAAGAAGGGGGATGGGTAGGGAAGAGAAAAATACGTGACAAAGAAAACATTCTTTGCCTG

GGAGGAGACTCCCAGAGGGTGTAGAGCTGGAGGGAGCATTCACTGGCCATGCCAGTACTTACCACTGATGCTGAGTCAGAAACAGGTATCCCAAAATCCC

TTTCCAATGAGCCTCCCTCAGAAACCATGGAGGAAATAGAGCACACATGCCCACAGCCTCGACTG - UNI2783 - ACCCTGACTGCACCAGCCCCAT

TTGCTGATGAATCCAGCTGCCAGTGCCAAGCACCTCATGAAAAACTGACCGTTGCCCAGGCCCGCTTAGGAACACCAG - UNI17430 - TTGATAGG

CCTGTTAGAGTGTATGCAGATGGAATATTTGACCTCTTCCACTCAGGTCACGCAAGGGCACTTATGCAAGCAAAAACACTGTTTCCCAACAGCTACTTGT

TGGTAGGAG - UNI25103 - TTTGCAGTGATGACCTTACTCACAAATTCAAAGGTTTTACTGTGATGAACGAGGCAGAGAGATATGAAGCTCTCAGA

CACTGTCGATACGTGGATGAAGTCATCAGAGACGCGCCATGGACTCTTACTCCAGAGTTTCTGGAAAAACACAAG - UNI16946 - ATTGACTTTGT

GGCTCACGATGATATTCCATACTCCTCTGCTGGTTCTGATGACGTTTATAAGCATATCAAGGAAGCAG - UNI6197 - GCATGTTTGTTCCAACACA

AAGAACAGAAGGCATCTCAACATCAGACATCATCACCAGAATTGTCCGTGACTATGATGTATATGCCCGGCGTAATCTCCAGAGAGGGTACACAGCCAAG

GAGCTGAACGTCAGCTTTATAAAC - UNI7499 - GAGAAGAAGTACCGTTTCCAGAACCAGGTGGACAAGATGAAAGAAAAGGTCAAGAATGTGGAA

GAAAGATCAAAGGAGTTTGTTAACAGAGTAGAAGAAAAGAGTCATGACCTAATTCAAAAGTGGGAAGAAAAATCAAGAGAGTTTATTGGCAACTTCCTGG

AACTGTTTGGGCCAGATGGTGCATGG AAGCAGATGTTCCAGGAGAGGAGTAGCCGGATGCTGCAGGCATTATCTCCGAAGCAGAGTCCTGTGAGCAGCC

CGACCCGGAGCCGGTCCCCTTCTCGCTCTCCATCTCCTACCTTCTCCTGGCTCCCAAACAAGACCTCTCCCCCCTCCTCACCCAAAGCAGCCTCAGCCTC

CATCAGCAGCATGAGCGAGGGGGATGAGGATGAGAAGTAAAGGTGCCTGGTCAACAAGAGCACACCACACAGGATGGGAAGGGCTCCCGGGATGCCTGGG

TGGTGTTGAGAGCTGCAGCTCTGCTGGGAGACGGGAGTTCTGCCATGGGAGTTACTAGGGCCAGCTCTTTTTCCTTCTCCATTCAGTCTGGCCTGGGCTC

AGCATGGAGGTTTCTGACCTGAAAACCCACACAGACCTTGTTAGCATCCTAGAAGCACCCTCACTTTAGCCCTGCTATGGAAAGGTGCAGAACACTCCAT

GAAGTGGGATGAGTTCTGCTTTGGTCCACACATCTATCTGTAGCCAATAAGCCACCCGCAGATGTGGCTGCTGCCTCGCCCTGCCCTCTCCAGTCCTCAA

AGAGCCTTGCACGTTGCCCCCTGTCACCCATGCTCTCCCAGAATGAATTCCCTTCCCACAATGGGCAAAGTTCAGCCTTCCCAGTACAGCCACTAAGGCT

GGATGGAATGCACCAACCCTTTCCCATTTCAGGACCCTGCCTCAGACGCAGCTTCGCGTTGGTCAGATAGAAAAGTGTGACCCTTAATCTCTCACTCAAA

GGACAGTTGTGTCAAGGTGAACTCCACCCAAGGCCTGCCATGCTTCTGGCTGTACATTTTCATCTTTGGCATGAGGAGACTGTTTTCCAGAAATTACCTG

AATTGATGGGAATCACAGCAAGGAAGCCCGTCTTATCTAAAAAAGAAATAACCACACAAACCTTCTTAGCAGGAGCTGCGCTGCTTTGGCTCCATGTATG

GAAGATGAAAAATATCTCTTGGAGCTTCTTAAAGGATCAGCTCTTTCCATTTCTGACCACATCACAGTTCATAGACTCGAATAACAGTTTGATGTAACAA

ACACTTAGTATACCGATAGGGGGTGCTACCTGCACGTATCTGTTCTATGTATCCTCCAATATGCCACCCCAGGGTGTATCCCATATGCAATATGAATCTA

TGGTGGTGGTGTTGGACTCTAGATCCCTCTCCTGCTCTCCCCCATGACACCCTGCTGAAATGCTTGATCTCAAGAACCGCCTGGTTCCCTCATGACTTGG

GCACTTTGTCAAAAGCTCAATCAAATGTTAGATTCCGGTAGAAATGTTTTGTCCCAGAAAATTCCTGTTGTTCTTCACCCATGACATTTTGGGTAAAGGG

AAGGCTCAATCTTTTGAATGGTCTGAGAGACACTGAAGTTATTTCTGGCCCTTGCTTCTCCAAATGGGATAGAGACTCTCAGATGACTGGAGAACTACAT

GGGGCCGCTGTTCCCTAATCACATGCAGGGAATGAGCAGGTCCAGTCAAGGTTTAGAGCTAATCTCTTAGGTACAAATAGAATTTCCTGAGTATCCTAGT

AAAGACAGAAAGACAGCACTGCAGCTTGACTAAGTGAAGGCCTTAACATGTAACTGGTGGGCAAAGTCCAACACCTCCAGTGACAGAAACACCCCCTGCC

TTCAGAGGCTTTGGGAACATGCATTCTGGGGGGGGGGTAGGGAGACAACTCATGAAGAAAGGTACCCTGTCTTTCCCCTTTGTGTTGGGGTCAAACTACC

TCCCTGCTCACCTGAAGATCAGTGGTGACTGTTGCTAAGGCAACCTGGAGCCTCCTTGTTCCTGGTACTTCTTCCAGAAGTTTGTAAAGTGCTCATGAAA

GATGGGGGATCGCTGGGAATCCAGCCTGCGAGAAAGAAACTTCTTTTCATAGTCAAGGCCCTCTTGGAGAATCACACCCCAGAGGCAAGGGCTTCCATTC

CTCCACGGTATCGGTTTGACCTCAGCCTCCCACCATGTACCCAGGACAAATTGTGCGTGTATGCCTTCTATTTCAGCCAGCTGACACTTGTGGCAGTGCA

GGGACAAGGAGAGCAACTGAGCAAATGAAGAAGAGGAGAAGAGGGTCCTAGAGAGAGGAAAGAAAGAAAGCTAAAACCATCTACGCTCTTAAGCCACTTC

TGGTTGTATGTGCGGAGACTCTCTGTTGAGGAAGCCTTTTTAAAAAGTTCTGGCTCTATGACCCAGGGCAGATAGGTCCACTTTTACCTAAGTCTTGCTC

TGAGGCAGAGAATGTAGAGGTGACATATCAGGTGAGTATAATTTTGCAGGCCCTACACACCATCCTGCCAGGTGCCACATACGTGACTCATCAGAGAGTG

CCACTGTAGCTGTGAATGATGGGAAGTGACCAACATCAGAATCATCCCAGGTACAAACAGACACTTAAGTGGGTTTAAACTTCCTTCTCAGTTTGCAACA

GCATCTCCTCACCTTCCCAAAGCCACGAGCTTGCCACCAAGAAATGGGGCGGATTCTGCTAGCCAACCTTTGGCCCTTCTTGACCATCTCACAGGCCTTC

CCAGCCCTGACCCAGGTTTACCACCCCCCACACCTGGGAGGAGCCATGACTGCACTTTGTGTGGGTTCTTCAGGCAATTCTCATGGTCAAGGGCGAGTTA

AGGATCGAATGACAGCATAACACGTGCTGCAGGCTTGGAGAAGTAAGAAAAGGGATAGAAGCCGGGGAATGGGCTCCTTTTCCTCCATGAAAGGAAAGAA

GCTACTTAGAGAACCCATTCCCTAAGGTTGGGAATGGGAAGATGGAAAAAATGACACTGGAGTTGGTGAGTATGGGAGGATTTATATTTTCTACTTTCCT

TCCAGGCATCACTAGGAAGGAGGAAGGCTTCCTATTGTATCCTTCCATGGCTAGTGGATCCCCATGCAGCAGGTGGGGTCCTGGCCTCTCCAGCTTCTTT

GGCATATTAGCAATTCTCATATCTCTCCCCACCCCTGGAAACCAAGTGCTGACTCTCCATGTAAACAACAGGGGTGTAGTTGTAATATGGTGTATGGCCC

ATGTCTGCCACAAATTGTCAGGATAACCCAGAGACAAAGATAAACCAGGCTTGTGACAGACACAGTGTGGCTTCTGACATGCTGTGGGTGGGGGAGACTC

AGCCATTCTATGACCTAGGCTACAAGATACTGCGGTTACACTGGTGGGTTGTGGCCACAGGAAGAACATGGCTTATTTTCCCTCAGTCTTCAGGACTTTT

TAAAATGCCCAGTCCTACTCCACAGATGAGACTGGTTTTCAGGCATCTACTCAGCAACTCCAGTCTTGTCCTAACCATCTGATGAGGAAGGAAGGAAGGA

AGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGTGAGCAAGAGATAAGTGAGCTCATTAGGCAAATTTTTTACTTCTCCTCTTCTCTAGTTTTCT

GTTGTGTCGCTGCAGTGTGTCTGGGGACAAAGCCATAAGAAGCCTATCTACTTAAAATTCTGCTGTACATAGAAGCCGAGGGCTTGTCTGGATTCAAGAA

TGATCTTATGCCCAAGCATTTGCTCTGGTGCTGAATAGTGCAAACTACTGGAACCACCCCAACCCTACCACTGAAACCCCTAGACCCAATCCAGTCTCCT

GATCCCCAATGGACCACAGTATTCCCAACTTGTTTATAAATAAAGGGACGCAGAGTC
Translation
MPVLTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRL - UNI2783 - TLTAPAPFADESSCQCQAPHEKLTVAQARLGTPV - UNI17430 - 

VDRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV - UNI25103 - VCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEF

LEKHK - UNI16946 - IDFVAHDDIPYSSAGSDDVYKHIKEAG - UNI6197 - GMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKE

LNVSFIN - UNI7499 - EKKYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAW KQMFQERSSRMLQALS

PKQSPVSSPTRSRSPSRSPSPTFSWLPNKTSPPSSPKAASASISSMSEGDEDEK
Transcript ENSMUST00000113933
Sequence
AGCCATCAGAGCGGACAGAGCACAGCAACTGTCAATGAACAACAGCCCAGAGGGGACAAGAGGACACTTGTAGAAAATCAAATAAAGCAAAGGACTGGAC

AGCTTGAATCTCTGCTTATCCAATAAACCAGACACTCCTAGTCCTTTGGATCTTATCTGTCAGCACTGGGCATATCAAGCTGCCTTGAACTTTTTAAACC

AATTGTCTCTCCCATACATCTAGAGCCACTAAACTTCTCCCTGTGACTCAAAAGAACTTGTAAGGGAGAAGACCTTAGAGACGAAAGAAAGTTGGGGCCA

AACCTTGTGGTACACCAGAAATGCAGCATGGACAAGGACGAATTCTCACGCAAG - UNI2783 - - UNI15375 - ACCCTGACTGCACCAGCCCC

ATTTGCTGATGAATCCAGCTGCCAGTGCCAAGCACCTCATGAAAAACTGACCGTTGCCCAGGCCCGCTTAGGAACACCAG - UNI17430 - TTGATA

GGCCTGTTAGAGTGTATGCAGATGGAATATTTGACCTCTTCCACTCAGGTCACGCAAGGGCACTTATGCAAGCAAAAACACTGTTTCCCAACAGCTACTT

GTTGGTAGGAG - UNI25103 - TTTGCAGTGATGACCTTACTCACAAATTCAAAGGTTTTACTGTGATGAACGAGGCAGAGAGATATGAAGCTCTCA

GACACTGTCGATACGTGGATGAAGTCATCAGAGACGCGCCATGGACTCTTACTCCAGAGTTTCTGGAAAAACACAAG - UNI16946 - ATTGACTTT

GTGGCTCACGATGATATTCCATACTCCTCTGCTGGTTCTGATGACGTTTATAAGCATATCAAGGAAGCAG - UNI6197 - GCATGTTTGTTCCAACA

CAAAGAACAGAAGGCATCTCAACATCAGACATCATCACCAGAATTGTCCGTGACTATGATGTATATGCCCGGCGTAATCTCCAGAGAGGGTACACAGCCA

AGGAGCTGAACGTCAGCTTTATAAAC - UNI7499 - GAGAAGAAGTACCGTTTCCAGAACCAGGTGGACAAGATGAAAGAAAAGGTCAAGAATGTGG

AAGAAAGATCAAAGGAGTTTGTTAACAGAGTAGAAGAAAAGAGTCATGACCTAATTCAAAAGTGGGAAGAAAAATCAAGAGAGTTTATTGGCAACTTCCT

GGAACTGTTTGGGCCAGATGGTGCATGG AAGCAGATGTTCCAGGAGAGGAGTAGCCGGATGCTGCAGGCATTATCTCCGAAGCAGAGTCCTGTGAGCAG

CCCGACCCGGAGCCGGTCCCCTTCTCGCTCTCCATCTCCTACCTTCTCCTGGCTCCCAAACAAGACCTCTCCCCCCTCCTCACCCAAAGCAGCCTCAGCC

TCCATCAGCAGCATGAGCGAGGGGGATGAGGATGAGAAGTAAAGGTGCCTGGTCAACAAGAGCACACCACACAGGATGGGAAGGGCTCCCGGGATGCCTG

GGTGGTGTTGAGAGCTGCAGCTCTGCTGGGAGACGGGAGTTCTGCCATGGGAGTTACTAGGGCCAGCTCTTTTTCCTTCTCCATTCAGTCTGGCCTGGGC

TCAGCATGGAGGTTTCTGACCTGAAAACCCACACAGACCTTGTTAGCATCCTAGAAGCACCCTCACTTTAGCCCTGCTATGGAAAGGTGCAGAACACTCC

ATGAAGTGGGATGAGTTCTGCTTTGGTCCACACATCTATCTGTAGCCAATAAGCCACCCGCAGATGTGGCTGCTGCCTCGCCCTGCCCTCTCCAGTCCTC

AAAGAGCCTTGCACGTTGCCCCCTGTCACCCATGCTCTCCCAGAATGAATTCCCTTCCCACAATGGGCAAAGTTCAGCCTTCCCAGTACAGCCACTAAGG

CTGGATGGAATGCACCAACCCTTTCCCATTTCAGGACCCTGCCTCAGACGCAGCTTCGCGTTGGTCAGATAGAAAAGTGTGACCCTTAATCTCTCACTCA

AAGGACAGTTGTGTCAAGGTGAACTCCACCCAAGGCCTGCCATGCTTCTGGCTGTACATTTTCATCTTTGGCATGAGGAGACTGTTTTCCAGAAATTACC

TGAATTGATGGGAATCACAGCAAGGAAGCCCGTCTTATCTAAAAAAGAAATAACCACACAAACCTTCTTAGCAGGAGCTGCGCTGCTTTGGCTCCATGTA

TGGAAGATGAAAAATATCTCTTGGAGCTTCTTAAAGGATCAGCTCTTTCCATTTCTGACCACATCACAGTTCATAGACTCGAATAACAGTTTGATGTAAC

AAACACTTAGTATACCGATAGGGGGTGCTACCTGCACGTATCTGTTCTATGTATCCTCCAATATGCCACCCCAGGGTGTATCCCATATGCAATATGAATC

TATGGTGGTGGTGTTGGACTCTAGATCCCTCTCCTGCTCTCCCCCATGACACCCTGCTGAAATGCTTGATCTCAAGAACCGCCTGGTTCCCTCATGACTT

GGGCACTTTGTCAAAAGCTCAATCAAATGTTAGATTCCGGTAGAAATGTTTTGTCCCAGAAAATTCCTGTTGTTCTTCACCCATGACATTTTGGGTAAAG

GGAAGGCTCAATCTTTTGAATGGTCTGAGAGACACTGAAGTTATTTCTGGCCCTTGCTTCTCCAAATGGGATAGAGACTCTCAGATGACTGGAGAACTAC

ATGGGGCCGCTGTTCCCTAATCACATGCAGGGAATGAGCAGGTCCAGTCAAGGTTTAGAGCTAATCTCTTAGGTACAAATAGAATTTCCTGAGTATCCTA

GTAAAGACAGAAAGACAGCACTGCAGCTTGACTAAGTGAAGGCCTTAACATGTAACTGGTGGGCAAAGTCCAACACCTCCAGTGACAGAAACACCCCCTG

CCTTCAGAGGCTTTGGGAACATGCATTCTGGGGGGGGGGTAGGGAGACAACTCATGAAGAAAGGTACCCTGTCTTTCCCCTTTGTGTTGGGGTCAAACTA

CCTCCCTGCTCACCTGAAGATCAGTGGTGACTGTTGCTAAGGCAACCTGGAGCCTCCTTGTTCCTGGTACTTCTTCCAGAAGTTTGTAAAGTGCTCATGA

AAGATGGGGGATCGCTGGGAATCCAGCCTGCGAGAAAGAAACTTCTTTTCATAGTCAAGGCCCTCTTGGAGAATCACACCCCAGAGGCAAGGGCTTCCAT

TCCTCCACGGTATCGGTTTGACCTCAGCCTCCCACCATGTACCCAGGACAAATTGTGCGTGTATGCCTTCTATTTCAGCCAGCTGACACTTGTGGCAGTG

CAGGGACAAGGAGAGCAACTGAGCAAATGAAGAAGAGGAGAAGAGGGTCCTAGAGAGAGGAAAGAAAGAAAGCTAAAACCATCTACGCTCTTAAGCCACT

TCTGGTTGTATGTGCGGAGACTCTCTGTTGAGGAAGCCTTTTTAAAAAGTTCTGGCTCTATGACCCAGGGCAGATAGGTCCACTTTTACCTAAGTCTTGC

TCTGAGGCAGAGAATGTAGAGGTGACATATCAGGTGAGTATAATTTTGCAGGCCCTACACACCATCCTGCCAGGTGCCACATACGTGACTCATCAGAGAG

TGCCACTGTAGCTGTGAATGATGGGAAGTGACCAACATCAGAATCATCCCAGGTACAAACAGACACTTAAGTGGGTTTAAACTTCCTTCTCAGTTTGCAA

CAGCATCTCCTCACCTTCCCAAAGCCACGAGCTTGCCACCAAGAAATGGGGCGGATTCTGCTAGCCAACCTTTGGCCCTTCTTGACCATCTCACAGGCCT

TCCCAGCCCTGACCCAGGTTTACCACCCCCCACACCTGGGAGGAGCCATGACTGCACTTTGTGTGGGTTCTTCAGGCAATTCTCATGGTCAAGGGCGAGT

TAAGGATCGAATGACAGCATAACACGTGCTGCAGGCTTGGAGAAGTAAGAAAAGGGATAGAAGCCGGGGAATGGGCTCCTTTTCCTCCATGAAAGGAAAG

AAGCTACTTAGAGAACCCATTCCCTAAGGTTGGGAATGGGAAGATGGAAAAAATGACACTGGAGTTGGTGAGTATGGGAGGATTTATATTTTCTACTTTC

CTTCCAGGCATCACTAGGAAGGAGGAAGGCTTCCTATTGTATCCTTCCATGGCTAGTGGATCCCCATGCAGCAGGTGGGGTCCTGGCCTCTCCAGCTTCT

TTGGCATATTAGCAATTCTCATATCTCTCCCCACCCCTGGAAACCAAGTGCTGACTCTCCATGTAAACAACAGGGGTGTAGTTGTAATATGGTGTATGGC

CCATGTCTGCCACAAATTGTCAGGATAACCCAGAGACAAAGATAAACCAGGCTTGTGACAGACACAGTGTGGCTTCTGACATGCTGTGGGTGGGGGAGAC

TCAGCCATTCTATGACCTAGGCTACAAGATACTGCGGTTACACTGGTGGGTTGTGGCCACAGGAAGAACATGGCTTATTTTCCCTCAGTCTTCAGGACTT

TTTAAAATGCCCAGTCCTACTCCACAGATGAGACTGGTTTTCAGGCATCTACTCAGCAACTCCAGTCTTGTCCTAACCATCTGATGAGGAAGGAAGGAAG

GAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGTGAGCAAGAGATAAGTGAGCTCATTAGGCAAATTTTTTACTTCTCCTCTTCTCTAGTTTT

CTGTTGTGTCGCTGCAGTGTGTCTGGGGACAAAGCCATAAGAAGCCTATCTACTTAAAATTCTGCTGTACATAGAAGCCGAGGGCTTGTCTGGATTCAAG

AATGATCTTATGCCCAAGCATTTGCTCTGGTGCTGAATAGTGCAAACTACTGGAACCACCCCAACCCTACCACTGAAACCCCTAGACCCAATCCAGTCTC

CTGATCCCCAATGGACCACAGTATTCCCAACTTGTTTATAAATAAAGGGACGCAGAGTC
Translation
MDKDEFSRK - UNI2783 - - UNI15375 - TLTAPAPFADESSCQCQAPHEKLTVAQARLGTPV - UNI17430 - VDRPVRVYADGIFDLFH

SGHARALMQAKTLFPNSYLLVGV - UNI25103 - VCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHK - UNI16946 

- IDFVAHDDIPYSSAGSDDVYKHIKEAG - UNI6197 - GMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFIN - UNI7499

 - EKKYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAW KQMFQERSSRMLQALSPKQSPVSSPTRSRSPSR

SPSPTFSWLPNKTSPPSSPKAASASISSMSEGDEDEK

For any suggestions or comments, please send an email to unitrap@crg.es