Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035284 (Vps13c)
Chromosomal location
Chr 9: 67688203 - 67843441 (+)
Description
vacuolar protein sorting 13C (yeast) Gene [Source:MGI Symbol;Acc:MGI:2444207]
RefSeq_dna
NM_177184 
RefSeq_peptide
NP_796158.2 
UniGene
Mm.241454 
MGI
MGI:2444207 
Uniprot/SWISSPROT
Q8BX70 
Uniprot/SPTREMBL
A1ILH1 A1ILH0 A1ILG9 A1ILH2 A1ILH3 A1ILG8 
Human Ortholog
ENSG00000129003 (VPS13C)
Omim not available
UniTrap UNI10165
Vector Insertion
Chr 9: 67755879 - 67757368
Public Clones XB737 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7253
Vector Insertion
Chr 9: 67767179 - 67768665
Public Clones RRT161 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9738
Vector Insertion
Chr 9: 67780398 - 67782247
Public Clones XG142 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1505
Vector Insertion
Chr 9: 67782358 - 67784098
Public Clones CC0743 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1119
Vector Insertion
Chr 9: 67784269 - 67785465
Public Clones CC0266 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5637
Vector Insertion
Chr 9: 67793896 - 67795923
Public Clones CSI670 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9095
Vector Insertion
Chr 9: 67803601 - 67805307
Public Clones XK595 (baygenomics) XK596 (baygenomics) XK405 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1991
Vector Insertion
Chr 9: 67823713 - 67830311
Public Clones BC0001 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113629
Sequence
CTCCTGGTCCCCGCCATGGTGCTGGAGTCGGTGGTCGCTGACTTGCTGAACCGCTTCCTAGGGGACTACGTGGAGAACCTGAACAAGTCCCAGCTAAAGC

TGGGGATCTGGGGCG GTAATGTGGCTTTGGATAATCTGCAGATAAAAGAAAATGCTCTG AGTGAATTGGACGTTCCTTTCAAAGTCAAGGCTGGCCAG

ATTG ATAAATTAACTTTGAAGATTCCTTGGAAAAACCTTTATGGAGAAGCAGTCGTTGCCACGCTAGAAGGATTATACCTGCTTGTGGTCCCTGGAGCA

A GTATTAAGTATGACGCTGAGAAAGAAGAAAAATCCTTGCAGGATATTAAACAGAAAGAACTTTGCCGAATTGAAGAAGCCCTTCAGAAAGCAGCAGAG

AAAG ATAAGCCCAAAGAAGCAAAAAAGGATACATTTCTGGAAAAATTGGCAACTCAAGTAATAAAAAATGTTCAAGTGAAAATTACAGACATTCACATT

AAATATGAAGATGAT ATCACGGATCCAGAAAGGCCGCTTTCATTTGGTGTCACCCTGAGAGAATTTAGTCTGTTG ACAACTAATGAACACTGGACTCC

ATGCATTTTAAATGAAGCAGAAAAAATTATATATAAG CTCGTGAAGCTGGACAGTCTCAGCGCCTATTGGAACGTTGGCTGCTGCATGTCTTACCGTGG

ATCGAGGGAGCACATCTTG GAGCAACTGAAACGTGAAATTCTTACAAGTACAAACATCCCCCCAGACCATCAGTACA TTTTCCAGCCAATATCAGCCT

CTGCAAAACTCTACATGAATCCTGGTGCAGAATCAGAGCTCAAAACCCCCAAACTCGATGGGAACGTAGAGGTGCAGAATATTGCCATCGAGCTGACGAA

GCCTCAG TATTTAAGCATGATTGACTTTTTGGAGTCACTGGATTATATGGTTAGAAATGCACCATACAGGAAGTACAAACCTTGCTTGCCACTTCACAC

CAACTGTCGGCAATG GTGGAAATATGCTATTGATTCTGTTCTTGAAGTTCATATAAGAAGATATACTCAGCCATGGTCATGGAGTAACATAAAAAACCA

TAGGCAGTTACTCAAGAGTTACAAAATGGCCTACAAAACCAAGTTAACACAAGCCAAAGTCTCAGAAGAGATACAGAAACAAATACAG GACTTGGAGAA

GAGTCTAGATGTTTTTAACATAATTTTAGTGAGACAACAAGCACAAGTTGAG GTCATTCATTCTGGGCAGAAGTTAAGGAAAAAGTCTGCGGAGGCAGG

AGAGAAACGTGGCTGGTTTAGTGGGTTTTGGGGCAAGAAGGAATCTAAGAAGAGAGATGAGGAGTCTTCAGTCCCTGAGA CCATCGATGACCTTATGAC

TCCAGAGGAGAAGGACAAGCTCTTCACTGCCATTGGGTACAGTGAGAATGCCTACAACTTGGCTTTGCCCAAGCAG TATGTGGCCCATATACTGACTCT

GAAGTTGGTCAGCACCTCTATTATAATAAGAGAAAACAGGAATGTTCCAGAAATCTTGAGAGTCCAGATAATTGGCTTGGGTACCCAAGTCTCCCAGCGA

CCAGGAGCACAAGCATTGAA GATAGAAGCAAAATTAGAACACTGGTACGTCACAGGTTTGCGACAACAAGACATTGTGCCATCACTGGTGGCTTCCATT

GGTGACACTACATCGTCCTTGCTCAAAATTGAGTTTGAAACCAACCCTGAGAACAGTCCTGCTGACCAGACTCTGATTGTTCAGTCACAGCCCGTGGAGG

TCATCTATGACGCT AAAACTATCAATGCTGTTGTTGAATTCTTTCAGTCAAATAAGGGGTTGGATCTTGAGCAAATTACATCAGCTACCTTGATGAAAC

TGGAAGAGATTAAAGAGAGGACAGCTACAG GACTTACGCATATCATTGAGACTCGGAAAGTTCTCGATTTAAGGATAAATCTGAAGCCTTCTTACCTGA

TAATTCCACAGACAGGTTTTCACCATGAAAAGTCAAATCTTCTCATTTTAGATTTTGGTACTTTTCAG CTCAACAGTAAAGACCAAGGCGCACAGAAGA

CTGCTAATGCATCCCTTGAAGAAATAATAGACAAGGCGTATGACAAGTTTGATGTGGAGATAAGGAGTGTGCAGTTGCTCTTTGCAAAAGCAG ATTTAA

AGTGTCAGGAGGACTGCCTTTGATGCATGTGAGGATTTCTGACCAGAAGATAAAGGATGCGCTGTGTTTGATTAACAGTATACCTTTGCCACAGAAGTCA

TCCACACCGTCTCCAGAGAGACAG GTAGCCTCAATTCCTGTTCTTTCAGGAGGGACGAAAGCACTTCTTGGGACTTCATTGTTGCTAGATGGAGTGGAA

TCAG AGTCTGACGAGGAGTTCTTTGATGCTGAGGACGGAGACTCGCAGGCTGCTAGAACTGTCAAAGCCTCAGAACTGAAAAAAGCTGCTGAAGTTCCA

AATGAGGAGCTGGTTAGTCTCCTGCTCAAGTTTGAGATTAAAGAG GTGGTTTTGGAACTCACT
Translation
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGG GNVALDNLQIKENAL SELDVPFKVKAGQID DKLTLKIPWKNLYGEAVVATLEGLYLLVVPGAS

 SIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKD DKPKEAKKDTFLEKLATQVIKNVQVKITDIHIKYEDD ITDPERP                  

Transcript ENSMUST00000113630
Sequence
CTCCTGGTCCCCGCCATGGTGCTGGAGTCGGTGGTCGCTGACTTGCTGAACCGCTTCCTAGGGGACTACGTGGAGAACCTGAACAAGTCCCAGCTAAAGC

TGGGGATCTGGGGCG GTAATGTGGCTTTGGATAATCTGCAGATAAAAGAAAATGCTCTG AGTGAATTGGACGTTCCTTTCAAAGTCAAGGCTGGCCAG

ATTG ATAAATTAACTTTGAAGATTCCTTGGAAAAACCTTTATGGAGAAGCAGTCGTTGCCACGCTAGAAGGATTATACCTGCTTGTGGTCCCTGGAGCA

A GTATTAAGTATGACGCTGAGAAAGAAGAAAAATCCTTGCAGGATATTAAACAGAAAGAACTTTGCCGAATTGAAGAAGCCCTTCAGAAAGCAGCAGAG

AAAG GTGCACACTCAGGGGAGTTCATGTATGGCTTGGAAAACTTGCTTTACAAGGACGTCAAGCCTG ATAAGCCCAAAGAAGCAAAAAAGGATACATT

TCTGGAAAAATTGGCAACTCAAGTAATAAAAAATGTTCAAGTGAAAATTACAGACATTCACATTAAATATGAAGATGAT ATCACGGATCCAGAAAGGCC

GCTTTCATTTGGTGTCACCCTGAGAGAATTTAGTCTGTTG ACAACTAATGAACACTGGACTCCATGCATTTTAAATGAAGCAGAAAAAATTATATATAA

G CTCGTGAAGCTGGACAGTCTCAGCGCCTATTGGAACGTTGGCTGCTGCATGTCTTACCGTGGATCGAGGGAGCACATCTTG GAGCAACTGAAACGTG

AAATTCTTACAAGTACAAACATCCCCCCAGACCATCAGTACA TTTTCCAGCCAATATCAGCCTCTGCAAAACTCTACATGAATCCTGGTGCAGAATCAG

AGCTCAAAACCCCCAAACTCGATGGGAACGTAGAGGTGCAGAATATTGCCATCGAGCTGACGAAGCCTCAG TATTTAAGCATGATTGACTTTTTGGAGT

CACTGGATTATATGGTTAGAAATGCACCATACAGGAAGTACAAACCTTGCTTGCCACTTCACACCAACTGTCGGCAATG GTGGAAATATGCTATTGATT

CTGTTCTTGAAGTTCATATAAGAAGATATACTCAGCCATGGTCATGGAGTAACATAAAAAACCATAGGCAGTTACTCAAGAGTTACAAAATGGCCTACAA

AACCAAGTTAACACAAGCCAAAGTCTCAGAAGAGATACAGAAACAAATACAG GACTTGGAGAAGAGTCTAGATGTTTTTAACATAATTTTAGTGAGACA

ACAAGCACAAGTTGAG GTCATTCATTCTGGGCAGAAGTTAAGGAAAAAGTCTGCGGAGGCAGGAGAGAAACGTGGCTGGTTTAGTGGGTTTTGGGGCAA

GAAGGAATCTAAGAAGAGAGATGAGGAGTCTTCAGTCCCTGAGA CCATCGATGACCTTATGACTCCAGAGGAGAAGGACAAGCTCTTCACTGCCATTGG

GTACAGTGAGAATGCCTACAACTTGGCTTTGCCCAAGCAG TATGTGGCCCATATACTGACTCTGAAGTTGGTCAGCACCTCTATTATAATAAGAGAAAA

CAGGAATGTTCCAGAAATCTTGAGAGTCCAGATAATTGGCTTGGGTACCCAAGTCTCCCAGCGACCAGGAGCACAAGCATTGAA GATAGAAGCAAAATT

AGAACACTGGTACGTCACAGGTTTGCGACAACAAGACATTGTGCCATCACTGGTGGCTTCCATTGGTGACACTACATCGTCCTTGCTCAAAATTGAGTTT

GAAACCAACCCTGAGAACAGTCCTGCTGACCAGACTCTGATTGTTCAGTCACAGCCCGTGGAGGTCATCTATGACGCT AAAACTATCAATGCTGTTGTT

GAATTCTTTCAGTCAAATAAGGGGTTGGATCTTGAGCAAATTACATCAGCTACCTTGATGAAACTGGAAGAGATTAAAGAGAGGACAGCTACAG GACTT

ACGCATATCATTGAGACTCGGAAAGTTCTCGATTTAAGGATAAATCTGAAGCCTTCTTACCTGATAATTCCACAGACAGGTTTTCACCATGAAAAGTCAA

ATCTTCTCATTTTAGATTTTGGTACTTTTCAG CTCAACAGTAAAGACCAAGGCGCACAGAAGACTGCTAATGCATCCCTTGAAGAAATAATAGACAAGG

CGTATGACAAGTTTGATGTGGAGATAAGGAGTGTGCAGTTGCTCTTTGCAAAAGCAG ATTTAAAGTGTCAGGAGGACTGCCTTTGATGCATGTGAGGAT

TTCTGACCAGAAGATAAAGGATGCGCTGTGTTTGATTAACAGTATACCTTTGCCACAGAAGTCATCCACACCGTCTCCAGAGAGACAG GTAGCCTCAAT

TCCTGTTCTTTCAGGAGGGACGAAAGCACTTCTTGGGACTTCATTGTTGCTAGATGGAGTGGAATCAG AGTCTGACGAGGAGTTCTTTGATGCTGAGGA

CGGAGACTCGCAGGCTGCTAGAACTGTCAAAGCCTCAGAACTGAAAAAAGCTGCTGAAGTTCCAAATGAGGAGCTGGTTAGTCTCCTGCTCAAGTTTGAG

ATTAAAGAG GTGGTTTTGGAACTCACT
Translation
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGG GNVALDNLQIKENAL SELDVPFKVKAGQID DKLTLKIPWKNLYGEAVVATLEGLYLLVVPGAS

 SIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKG GAHSGEFMYGLENLLYKDVKPD DKPKEAKKDTFLEKLATQVIKNVQVKITDIHIKYEDD IT

DPERP                  
Transcript ENSMUST00000056871
Sequence
CTCCTGGTCCCCGCCATGGTGCTGGAGTCGGTGGTCGCTGACTTGCTGAACCGCTTCCTAGGGGACTACGTGGAGAACCTGAACAAGTCCCAGCTAAAGC

TGGGGATCTGGGGCG GTAATGTGGCTTTGGATAATCTGCAGATAAAAGAAAATGCTCTG AGTGAATTGGACGTTCCTTTCAAAGTCAAGGCTGGCCAG

ATTG ATAAATTAACTTTGAAGATTCCTTGGAAAAACCTTTATGGAGAAGCAGTCGTTGCCACGCTAGAAGGATTATACCTGCTTGTGGTCCCTGGAGCA

A GTATTAAGTATGACGCTGAGAAAGAAGAAAAATCCTTGCAGGATATTAAACAGAAAGAACTTTGCCGAATTGAAGAAGCCCTTCAGAAAGCAGCAGAG

AAAG GTGCACACTCAGGGGAGTTCATGTATGGCTTGGAAAACTTGCTTTACAAGGACGTCAAGCCTG GACGTAAGCGTAAAAAGCACAAAAAACATTT

TAAGAAACGTTTTAAAGGTCTTGATCGCTCCAAAG ATAAGCCCAAAGAAGCAAAAAAGGATACATTTCTGGAAAAATTGGCAACTCAAGTAATAAAAAA

TGTTCAAGTGAAAATTACAGACATTCACATTAAATATGAAGATGAT ATCACGGATCCAGAAAGGCCGCTTTCATTTGGTGTCACCCTGAGAGAATTTAG

TCTGTTG ACAACTAATGAACACTGGACTCCATGCATTTTAAATGAAGCAGAAAAAATTATATATAAG CTCGTGAAGCTGGACAGTCTCAGCGCCTATT

GGAACGTTGGCTGCTGCATGTCTTACCGTGGATCGAGGGAGCACATCTTG GAGCAACTGAAACGTGAAATTCTTACAAGTACAAACATCCCCCCAGACC

ATCAGTACA TTTTCCAGCCAATATCAGCCTCTGCAAAACTCTACATGAATCCTGGTGCAGAATCAGAGCTCAAAACCCCCAAACTCGATGGGAACGTAG

AGGTGCAGAATATTGCCATCGAGCTGACGAAGCCTCAG TATTTAAGCATGATTGACTTTTTGGAGTCACTGGATTATATGGTTAGAAATGCACCATACA

GGAAGTACAAACCTTGCTTGCCACTTCACACCAACTGTCGGCAATG GTGGAAATATGCTATTGATTCTGTTCTTGAAGTTCATATAAGAAGATATACTC

AGCCATGGTCATGGAGTAACATAAAAAACCATAGGCAGTTACTCAAGAGTTACAAAATGGCCTACAAAACCAAGTTAACACAAGCCAAAGTCTCAGAAGA

GATACAGAAACAAATACAG GACTTGGAGAAGAGTCTAGATGTTTTTAACATAATTTTAGTGAGACAACAAGCACAAGTTGAG GTCATTCATTCTGGGC

AGAAGTTAAGGAAAAAGTCTGCGGAGGCAGGAGAGAAACGTGGCTGGTTTAGTGGGTTTTGGGGCAAGAAGGAATCTAAGAAGAGAGATGAGGAGTCTTC

AGTCCCTGAGA CCATCGATGACCTTATGACTCCAGAGGAGAAGGACAAGCTCTTCACTGCCATTGGGTACAGTGAGAATGCCTACAACTTGGCTTTGCC

CAAGCAG TATGTGGCCCATATACTGACTCTGAAGTTGGTCAGCACCTCTATTATAATAAGAGAAAACAGGAATGTTCCAGAAATCTTGAGAGTCCAGAT

AATTGGCTTGGGTACCCAAGTCTCCCAGCGACCAGGAGCACAAGCATTGAA GATAGAAGCAAAATTAGAACACTGGTACGTCACAGGTTTGCGACAACA

AGACATTGTGCCATCACTGGTGGCTTCCATTGGTGACACTACATCGTCCTTGCTCAAAATTGAGTTTGAAACCAACCCTGAGAACAGTCCTGCTGACCAG

ACTCTGATTGTTCAGTCACAGCCCGTGGAGGTCATCTATGACGCT AAAACTATCAATGCTGTTGTTGAATTCTTTCAGTCAAATAAGGGGTTGGATCTT

GAGCAAATTACATCAGCTACCTTGATGAAACTGGAAGAGATTAAAGAGAGGACAGCTACAG GACTTACGCATATCATTGAGACTCGGAAAGTTCTCGAT

TTAAGGATAAATCTGAAGCCTTCTTACCTGATAATTCCACAGACAGGTTTTCACCATGAAAAGTCAAATCTTCTCATTTTAGATTTTGGTACTTTTCAG 

CTCAACAGTAAAGACCAAGGCGCACAGAAGACTGCTAATGCATCCCTTGAAGAAATAATAGACAAGGCGTATGACAAGTTTGATGTGGAGATAAGGAGTG

TGCAGTTGCTCTTTGCAAAAGCAG ATTTAAAGTGTCAGGAGGACTGCCTTTGATGCATGTGAGGATTTCTGACCAGAAGATAAAGGATGCGCTGTGTTT

GATTAACAGTATACCTTTGCCACAGAAGTCATCCACACCGTCTCCAGAGAGACAG GTAGCCTCAATTCCTGTTCTTTCAGGAGGGACGAAAGCACTTCT

TGGGACTTCATTGTTGCTAGATGGAGTGGAATCAG AGTCTGACGAGGAGTTCTTTGATGCTGAGGACGGAGACTCGCAGGCTGCTAGAACTGTCAAAGC

CTCAGAACTGAAAAAAGCTGCTGAAGTTCCAAATGAGGAGCTGGTTAGTCTCCTGCTCAAGTTTGAGATTAAAGAG GTGGTTTTGGAACTCACT
Translation
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGG GNVALDNLQIKENAL SELDVPFKVKAGQID DKLTLKIPWKNLYGEAVVATLEGLYLLVVPGAS

 SIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKG GAHSGEFMYGLENLLYKDVKPG GRKRKKHKKHFKKRFKGLDRSKD DKPKEAKKDTFLEKLA

TQVIKNVQVKITDIHIKYEDD ITDPERP                  
Transcript ENSMUST00000098601
Sequence
CTCCTCCCTCTCCCGCCTCCTGGTCCCCGCCATGGTGCTGGAGTCGGTGGTCGCTGACTTGCTGAACCGCTTCCTAGGGGACTACGTGGAGAACCTGAAC

AAGTCCCAGCTAAAGCTGGGGATCTGGGGCG GTAATGTGGCTTTGGATAATCTGCAGATAAAAGAAAATGCTCTG AGTGAATTGGACGTTCCTTTCAA

AGTCAAGGCTGGCCAGATTG ATAAATTAACTTTGAAGATTCCTTGGAAAAACCTTTATGGAGAAGCAGTCGTTGCCACGCTAGAAGGATTATACCTGCT

TGTGGTCCCTGGAGCAA GTATTAAGTATGACGCTGAGAAAGAAGAAAAATCCTTGCAGGATATTAAACAGAAAGAACTTTGCCGAATTGAAGAAGCCCT

TCAGAAAGCAGCAGAGAAAG GTGCACACTCAGGGGAGTTCATGTATGGCTTGGAAAACTTGCTTTACAAGGACGTCAAGCCTG GACGTAAGCGTAAAA

AGCACAAAAAACATTTTAAGAAACGTTTTAAAGGTCTTGATCGCTCCAAAG ATAAGCCCAAAGAAGCAAAAAAGGATACATTTCTGGAAAAATTGGCAA

CTCAAGTAATAAAAAATGTTCAAGTGAAAATTACAGACATTCACATTAAATATGAAGATGAT ATCACGGATCCAGAAAGGCCGCTTTCATTTGGTGTCA

CCCTGAGAGAATTTAGTCTGTTG ACAACTAATGAACACTGGACTCCATGCATTTTAAATGAAGCAGAAAAAATTATATATAAG CTCGTGAAGCTGGAC

AGTCTCAGCGCCTATTGGAACGTTGGCTGCTGCATGTCTTACCGTGGATCGAGGGAGCACATCTTG GAGCAACTGAAACGTGAAATTCTTACAAGTACA

AACATCCCCCCAGACCATCAGTACA TTTTCCAGCCAATATCAGCCTCTGCAAAACTCTACATGAATCCTGGTGCAGAATCAGAGCTCAAAACCCCCAAA

CTCGATGGGAACGTAGAGGTGCAGAATATTGCCATCGAGCTGACGAAGCCTCAG TATTTAAGCATGATTGACTTTTTGGAGTCACTGGATTATATGGTT

AGAAATGCACCATACAGGAAGTACAAACCTTGCTTGCCACTTCACACCAACTGTCGGCAATG GTGGAAATATGCTATTGATTCTGTTCTTGAAGTTCAT

ATAAGAAGATATACTCAGCCATGGTCATGGAGTAACATAAAAAACCATAGGCAGTTACTCAAGAGTTACAAAATGGCCTACAAAACCAAGTTAACACAAG

CCAAAGTCTCAGAAGAGATACAGAAACAAATACAG GACTTGGAGAAGAGTCTAGATGTTTTTAACATAATTTTAGTGAGACAACAAGCACAAGTTGAG 

GTCATTCATTCTGGGCAGAAGTTAAGGAAAAAGTCTGCGGAGGCAGGAGAGAAACGTGGCTGGTTTAGTGGGTTTTGGGGCAAGAAGGAATCTAAGAAGA

GAGATGAGGAGTCTTCAGTCCCTGAGA CCATCGATGACCTTATGACTCCAGAGGAGAAGGACAAGCTCTTCACTGCCATTGGGTACAGTGAGAATGCCT

ACAACTTGGCTTTGCCCAAGCAG TATGTGGCCCATATACTGACTCTGAAGTTGGTCAGCACCTCTATTATAATAAGAGAAAACAGGAATGTTCCAGAAA

TCTTGAGAGTCCAGATAATTGGCTTGGGTACCCAAGTCTCCCAGCGACCAGGAGCACAAGCATTGAA GATAGAAGCAAAATTAGAACACTGGTACGTCA

CAGGTTTGCGACAACAAGACATTGTGCCATCACTGGTGGCTTCCATTGGTGACACTACATCGTCCTTGCTCAAAATTGAGTTTGAAACCAACCCTGAGAA

CAGTCCTGCTGACCAGACTCTGATTGTTCAGTCACAGCCCGTGGAGGTCATCTATGACGCT AAAACTATCAATGCTGTTGTTGAATTCTTTCAGTCAAA

TAAGGGGTTGGATCTTGAGCAAATTACATCAGCTACCTTGATGAAACTGGAAGAGATTAAAGAGAGGACAGCTACAG GACTTACGCATATCATTGAGAC

TCGGAAAGTTCTCGATTTAAGGATAAATCTGAAGCCTTCTTACCTGATAATTCCACAGACAGGTTTTCACCATGAAAAGTCAAATCTTCTCATTTTAGAT

TTTGGTACTTTTCAG CTCAACAGTAAAGACCAAGGCGCACAGAAGACTGCTAATGCATCCCTTGAAGAAATAATAGACAAGGCGTATGACAAGTTTGAT

GTGGAGATAAGGAGTGTGCAGTTGCTCTTTGCAAAAGCAG AGGAAAATTGGAAAAAGTGTAGATTCCAGCATCCATCGACTATGCATATACTGCAGCCA

ATGGATATTCACGTTGAGTTGGCCAAGGCAATGGTGGAGAAGGATGTTAGAATGGCCAA ATTTAAAGTGTCAGGAGGACTGCCTTTGATGCATGTGAGG

ATTTCTGACCAGAAGATAAAGGATGCGCTGTGTTTGATTAACAGTATACCTTTGCCACAGAAGTCATCCACACCGTCTCCAGAGAGACAG GTAGCCTCA

ATTCCTGTTCTTTCAGGAGGGACGAAAGCACTTCTTGGGACTTCATTGTTGCTAGATGGAGTGGAATCAG AGTCTGACGAGGAGTTCTTTGATGCTGAG

GACGGAGACTCGCAGGCTGCTAGAACTGTCAAAGCCTCAGAACTGAAAAAAGCTGCTGAAGTTCCAAATGAGGAGCTGGTTAGTCTCCTGCTCAAGTTTG

AGATTAAAGAG GTGGTTTTGGAACTCACTAAACAACAGAAAGAAGAAGAGACAATCCTAGTATTTAATGTCACTCAGTTAGGGACAGAAGCAACAATGA

GGACATTTGACCTGACTGCGGTGTCCTATTTGAGGAAAATCAGCTTGGATTACCATGACATTAAAG GATCCAGAAAGAAGCCAATTCACTTGATTAGCT

CTTCAGACAGACCTGGACTAGATCTTTTAAAAGTGGAGTACATTAAG - UNI10165 - GTTGATAGGAATGGGCCTAGTTTTCAAACTACTTTTGAG

AAAACTGAACAAACTGTTAAG GTGGCCTTTTCATCTTTGAATCTGTTGCTACAAACGCAAGCTCTTCTGTCTTCTCTTAACTACTTGACAACTGTCATC

CCATCAGACAGTCAGAACACGGGTGTGGCCAAGGAGGTGCAGGCCATGCCTGAGAAACAAAAGAACTCTCCCCTGCAGAAAG TGATGGTCCCCTCCAGA

GATAGTGACGTGATTGGCTTTAGGCTGTTTGCCAAACTGAATGCTTTCTGTGTCACTGTCTGTGATGAGAAGAGCAATATTGCTGAAATCAAGATACAAG

 GCCTTGATTCTTCTCTTTCTCTTCAATCAAAGAAGCAGTCACTTTTTGCCAGGCTGGAAAACATTATTGTCACAGATGTTGATCCCAAAACAATTCATA

AGAAA GCTGTATCCATAGTTGGGAATGAAGTTTTTCGCTTTAACCTGGATTTGTATCCGGATGCTACTGAAGGGGATTCCTACACTGACATGTCCACAG

TGGATGGCGTGGTGGCACTGCACGTCGGCTGTATTCAGATTGTCTACCTTCATAAATTCCTTATGTCGCTGCTG AGCTTCCTGAACAATTTCCAGGTGG

CCAAGGAGGCGCTGAGTGCAGCCACTGCCCAGGCTGCGGAAAAGGCGGCCACGAGCGTGAAGGATCTCGCCCAGAGAAGCTTCCGTGTTTCTGTCGATAT

TGATTTGAAAGCACCCGTCATTGTCATTCCGCAGTCCTCTCTCTCCACCAATGCTGTTGTGGTGGATCTTGGGCTAATTAGAGTTCACAATCGGTTCAGT

CTGGTGTCTGGAGAAGACACTGCAAATCCTCCAGTGATCGACAAAATGGAGGTGCAGCTCACGAAACTGAAACTCTCTAG GACAGCAATCCAGCCAGGC

ACCTCCCACCCTGATATTCAGCTGTTGCACCCAATTAACTTGGAGTTTTTTGTAAGTCGGAATCTAGCTGCAAATTGGTACCATAAGGTGCCTGTTGTAG

AAATTAAAGGGCGTCTTGACTCAATGAAT GTTAGTCTAAATCAAGAGGATCTTAATCTTCTGTTTAGAATATTGGCAGAAAATCTTGGCGAGGCCACTG

AAGACTTGGATAAAGGGAAACCTAGAATACAAGAGAGAG GTGAAACAAAAGCCTGCCGAGAAGTCTCTACACCGCAGGATGTGCACACCACACAAGGTG

TGCCAGCAGCCAGAGTGGAGGAGACCAGACCCGTAGACATCATTAATGTACTGTTGAACTTTGAAATTAAAGAG - UNI7253 - GTTGTGGTTACTT

TGATGAAAAAAGCAGAAAGGAAAGGAAGCCCCTTTCATGAACTAAAGATCCTGCATCTTGGGATGGAAGCTAAAGTAAAAGCCCACGACATGACTGCTGC

AGCCTACCTCAGGAACATTAGCATGCGGTGTTTCCACTTCCCTG ATTCTAAAGGGGAGCCTCTGCGCATTGTCAACACCTCTGATGTGTCTGATGGGAT

CCTCCTGAAACTGCTGTTCATCAAG GCAGACAGTGATGGACCAGACTTTAAGACCATTCATGATAACACCAAACAGAAGCTGAAG GTTTCGTTTTCAT

CCTTGGACTTGGTACTTCATTTGGAAGCTTTACTTTCCCTCATGGATTTTTTGTCATCTGCTATCCCATCCTCTGACTCTTCTTCCTCTGAGAAGGAACC

TGAGCTAAAGCCACTTGTGGGGGAGTCCAGAAGTCTTGCCATCAGAGCCG TGCCCAGCTCTTATGAGGGTGACGCGTTTGATTTGAAGATCACAGCTGA

ATTAAATGCCTTTAACATCTTCATTTGTGATCAGAAGAGTAACATAGCAGAAATTAAAATACATG GAATGGATGCCTCGATTTCTGTGAAGCCAAAGCA

GACTGATGTATTTGCCAGACTTAAGAATATCATAGTTATGAATGTTGATTCACTGTCCATTCACAAAAAG GCTGTCTCTATTTTGGGAGATGAAGTCTT

CCGGTTCCAGATGAGTCTGTATCCAGATGCCACAGAAGGAGAGAATTATGGCGATATGTCTAAAGTGGATGGCAGACTTAGTCTCAAAGTGGGCTGTATT

CAGATTGTCTATGTTCATAAATTCTTTATGTCTCTCTTG AGCTTCCTCAACAATTTCCAAGCTGCCAAGGAAGCCTTGAGCACAGCCACAGTCCAGGCT

GCAGAGAGAGCTGCGTCCAGTGTGAAGGACCTGGCCCAGAAGAGCTTCCGGCTTCTGATGGACATCGATTTGAAAGCACCTGTCATCACTATTCCCCAGT

CTTCTGTGTCACCAAATGTCGTTATAGCAGATCTGGGCTTGATCAGAGTTGAGAACAAGTTTAGCTTGGTTTCTGTGGAGCAGCTCGCGCTTCCCCCAGT

GGCCGACGAGATGAGCATCCAGCTCACCCAGCTGAAGCTTGCCAG AACTGTTTTACAAGCTGATTCACCTCAGCATGACGTTGAAATCTTAAAACCTGT

GAACATGCTTTTATGCATACAGCGGAATTTGTCAGCAGCGTGGTACACACAGATTCCAGGCATGGAGATAAAAGGCGAACTTAAACCTATGCAG GTTGC

TCTCAGTCAAGATGACTTGACAGTTTTAATGAAAATTTTGCTGGAAAACCTTGGGGAAGCTTCTTCACAACCAAGCCCTACACAGTATGCACAGGAGGCT

GCACGGGTGAAGAGAGATACTCGGAGTGGGCCTGACTATCTTAAAG - UNI9738 - AACAAGAGCTGGCGGACCCAAAGCCGCCCGGGGACCAGACC

GTCACTCTTCAGTTTGATTTCCACTTTGACTCTCTTTCCATCATCCTTTACAACAGTGATAGCAGCCAG - UNI1505 - GAGCCCAGGCTTTCATTT

CACAATGACAGTTTCCGTTTGGGTGAGCTCACACTACACCTGATGGCTTCTGCTGGGAAGATGTTCAAGGATGGGTCTATGAATGTCAGCCTTAAACTTA

AGACGTGCACGCTTGATGATCTCCGAGAAGGAATCGAGAGAGCCACCTCCAG - UNI1119 - GATGATTGACAAAAAGAATGACCAGGACAACAACA

GCTCTATGATTGATATAAGTTATAGCCAGGATAAAAATGGAAGCCAGGTCGATGCTGTCCTTGACAAGCTGTACGTGTGTGCCAGTGTGGAGTTTCTGAT

GACCGTGGCTGATTTCTTCATCAAAGCTATGCCTCAGAGTCCAGAAAACATAGCCAAAGAAATACAGATTCCATCAAGACAGACTGCCGCGGGAAGAGTC

AAGATGGAGAAAG ATGACTCTGTGAGGCCAAATATGACTCTGAAGGCCATGATCACAGACCCAGAAGTGGTGTTTGTTGCCAGCCTGACTAAGGCCGAT

GCTCCCGCTCTCACGGCCTCCTTCCAGTGCAACCTCTCCCTCTCAACGTCCAAACTGGAGCAGATGATGGAAGCTTCTGTGAGAGACCTGAAAGTGCTGG

CCTGCCCTTTCCTCAGAGAAAGGAGAGGAAAGAGCATCACCACG GTGTTGCAACCTTGCTCCTTATTTATGGAAAAGTGCACATGGGCTTCCGGGAAAC

AAAACATCAATATTGTGGTTAAAGAGTTTGTGATTAAG ATCTCACCTATAATCCTTAATACTGTAATGACAATCATGGCTGCTATGTCTCCAAAGACCA

AAGAAGATGAATGGAAAGACACTCCTAAGGAGACAGACAATCTCTGGGCTGTCAAATCTATTACTGATTATAACTCTTGGTTTCTCGGGGTTGACATGGC

AACAGAAGTAACAGAAAATTTTAGAGACTCTGAACATCCATCGATAGAGGAAAATTGTGTGGTTGCTGTGGAGTCAGTTCAAGTCACCTTAGAGTGTGGC

CTAGGGCATCGCACTGTGCCCCTGTTATTGGCAGAGTCCAAGTTCTCTGGAAATATTAAAAACTGGACTTCTCTAATGGCCGCTGCTGCTGACATGACAC

TAGAG GTTCACTATTACAATGAAACTCATGCCGTCTGGGAGCCACTGATTGAAAGAGTGGAGGGGAACAAGCCGTGGAGCTTAAAGCTTAAT GTAAAG

AAAAACCCGATCCAGGATAAAAGTTTGATGCCAGGAGATGACTTTATTCCTGAGCCACAAACAGCAGTTCATATTTCTTCAGGAGCTACGATGAATATCA

CAATATCCAAAAGCTGTCTTAATGTTTTCAGCAATTTAGCAAAA GGTTTCTCCGAGGGAGCGGCTTCTACGTTTGACTACTCTCTGAAAGACAGGGCTC

CTTTTACAGTCAAAAATGCGCTGGGTGTCCCCATGAAGGTGCAGCCCAATCGTAACCTCAAGGTCATGGGCTCCCCTGAGAAGAGTGACATTTATGACGT

GGGCGCTGGTCAGCACTTGGAGCTGGACTACGCCAGCCTGGAACCTTCGCGCCAAGGGAAGCTGTCCATCCTGAGCCGGCAGGAGAGCTCGCTCTTCACA

CTGACCTTTG - UNI5637 - TACCATATGGTTATACAGAAGTAGCTAGTGTTCCTGTCGCCAGGCCTGGCCGACGATTGTATAATGTGCGGAACCCC

AGTGCCAGCCATTCGGATTCCGTGTTGGTGCAGATTGACGCAACAGAAGGCAATAAGGTTGTCACTCTTCGCTCACCTCTGCAG ATTAAAAACCACTTC

TCAATAGCATTTATCATCTACAAATTTGTCAAGAATGTTAAGCTGTTGGAGCGCATCGGAATAGCCAGACCTGAGGAAGAGTTCCATGTTCCTCTGGATT

CCTATAG GTGCCAGTTGTATGTTCAGCCGGCTGGCGGCTTGGAGCAGCAGTACACACACTCCTCCACCTACATTTCCTGGAAGGAGGAGCTTCACCGCA

GCAGGGAGGTCAGGTGCATGCTGCAGTGTCCTGCAGTGGAAGTCAGCTTCCTACCCCTCATCGTGAACACGGTCGCTCTGCCCGATGAGCTGAGTTACAT

CGGTGCCCACGGGGAAGACTGGGATCCAGCCTACGTCATTCATCTTTACCCTCCTCTCACCTTGCGGAACCTTCTCCCGTATTCGCTAAGATACTTACTT

GAG GGAACCGCAGAAACCCACGAGCTGGCAGAAGGCAGTTCTGCTGACGTCCTTCACTCACGGATCAGTGGCGAGATCATAGAGCTCGTCCTGGTGAAA

TACCTGGGCAAGAACTGGAACGGACACTTCCGCATCTGTGACACACTTCCCGAGTTCTTCCTCGTGTGCTTTTCCTCAGACACTGCAGAAGTGATGACAG

TTGACCTGTCAGTTCACGTCAGGCGGATTGGCTGCCGAATGGAGCTGTCTGTCTTTAGTCCCTATTGGCTAATCAACAAAACTTCTCGGGTTCTCCAGTA

TCGCTCTGAGGAGATACATGTTAAACACCCAGCTGATTTCAGGGACATCATTTTATTCTCTTTCAAGAAGAAGAACATTTTTAGTAAAAACAAG GTACA

GCTAAAAATTTCAACCAGTGCCTGGTCCAATGGTTTCTCACTGGACACTGTGGGCAGTTACGGGTGTGTGAAGTGCCCGGCCACCAATATGGAATACCTG

 GTCGGGGTTAGCATCAAGATGAGCAGTTTTAATCTCTCACGAGTAGTCACTCTGACTCCCTTCTGTACTGTTGCAAATAAGTCCTCGTTAGACCTAGAA

GTTGGAGAGATTGCTTCAGATGGTTCCATACCCACCAACAAATGGCACTATGTTGCTTCGTCAGAG TGTATTCCATTTTGGCCTGAAAATTTGTCTGGC

AAACTTTGTGTGAGAGTGGTGGGCTACGAAGGCTCTTCCAAGCCATTCTTTTACAACCGACAAGACAACGGCACTTTATTGAGCTTAGAGGATCTG AAT

GGAGGCATCCTGGTGGACATAAACACTGCTGAACACTCAACTGTCATAACCTTCAGTGACTATCATGAGGGGTCTGCGCCTGCTCTGATAATGAACCACA

CACAGTGGGATGTCCTCACGTATAAACAGAG TGGGTCACAGGAGGAACTAGTATTGCTGCCAGGAGAAACTCGACTCTTTGCCTGGGCAGATCCCACTG

GCATCAGGAAACTCACTTGGAACTATGCAGCTAACTTTGGGGAGCATGATCTCTTAAAG - UNI9095 - GATGAGTGTGGTCAGTTTCCGTACGATG

CGAACATCCAGATACACTGGGTGTCCTTCCTTGATGGGCGCCAGAGGGTTCTGCTTTTCACAGATGATGTTGCTTTGGTTTCCAAAGCACTCCAAGCTGA

AGAAATGGAACAGGCCGATCACGAAGTAGCCTTGTCGCTCCACAGCCTCGGGCTCTCTCTGGTTAACAATGAAAACAAGCAGGAAGTCTCATATGTCGGA

ATCACCAG CTCAGGTGTTGTTTGGGAGATGAAGCCAAAACAGAAATGGAAGCCGTTTAGTCAGAAGCAGATAATGTCCCTGGAGCAGGCCTATTCGAAG

CGCCTTGCATCACAAGACCGCGGCTGGGTCAAGCTGGACAGTAATTTTGAG GTCAATTTTGACAAAGTGCCGATGGAAATGCGCCTCCCTATCCGGTGC

CCTATTAAACGGGACTTCTTATCAGGGATTCAGGTTGAGTTTAAGCAGTCTCCTCACCAGAGAAGCCTAAGGGCCCGGTTGTATTGGCTCCAG GTCGAT

AATCAGTTACCAGGCACAATGTTCCCAGTTGTATTTCACCCTGTGGCTCCTCCTAAGTCCATTGCTTTGGATTCAG AGCCCAAGCCTTTCATCGATGTG

AGTGTAATTACGAGGTTCAATGAGTACAGTAAAGTCTTACAGTTCAA GTATTTTATGGTTCTCATCCAGGAAATGGCCTTAAAGGTTGATCAGGGCTTC

CTTGGAGCTGTTATTTCACTGTTTACTCCCACAACTGATCCTGAGGCTGAAAGAAAACGG ACAAAGTTAATCCAACAAGATATTGATGCTCTCAACACA

GAGTTGATGGAGTCTTCAATGACTGATATGTCAATCCTGAGTTTCTTTGAACATTTCCACATTTCCCCTGTTAAG TTGCATCTGAGTCTGTCTTTGGGA

TCCGGAGGTGAGGAATCAGACAAAGAGAAACAGGAAATGATTGCAATTCATTCTGTGAACCTGCTGTTGAAGAGCATAGGTGCCACTCTGACGGACGTGG

ATGACCTCATATTCAA GCTTGCTTACTATGAGATTCGCTATCAGTTTTACAAGAGAGATCAGCTCATGTGGAGTGTTGTCAGACACTACAGTGAACAG 

TTCTTGAAGCAGATGTATGTGCTTGTATTGGGCTTAGACGTGCTTGGAAACCCATTTGGACTGATTAGGGGCCTGTCCGAAGGAGTTGAAGCACTGTTCT

ATGAGCCCTTCCAG GGTGCTGTCCAAGGTCCTGAAGAATTTGCTGAAGGATTAGTGATTGGGGTGAGAAGTCTCGTTGGACACACAGTAG GTGGTGCA

GCGGGAGTCGTATCTCGAATCACTGGGTCAGTTGGGAAAGGCCTGGCCGCAATTACAATGGACAAAGAGTATCAGCAGAAGAGAAGAGAGGAGATGGGGC

GACAGCCTAAAGATTTTGGAGACAGTCTTGCCAGAGGAGGGAAGGGCTTCCTGCGT GGAGTTGTTGGTGGGGTGACTGGAATAATAACAAAGCCCGTGG

AAG GTGCCAAGAAGGAGGGCGCTGCCGGCTTCTTTAAAGGAATTGGAAAAGGGCTTGTGGGTGCCGTGGCTCGTCCAACTGGCGGGATCATAGATATGG

CTAGCAGCACCTTCCAAGGCATTCAGAG - UNI1991 - GGTAGCAGAATCCACTGAGGAGGTGTCCAGCCTCCGTCCACCTCGTCTGATCCACGAAG

ACGGTATCATTCGTCCATATGACAGGCAGGAATCGGAGGGTTCCGACCTATTAGAG CAAGAGATGGGGACACAGGAGTAA
Translation
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGG GNVALDNLQIKENAL SELDVPFKVKAGQID DKLTLKIPWKNLYGEAVVATLEGLYLLVVPGAS

 SIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKG GAHSGEFMYGLENLLYKDVKPG GRKRKKHKKHFKKRFKGLDRSKD DKPKEAKKDTFLEKLA

TQVIKNVQVKITDIHIKYEDD ITDPERPLSFGVTLREFSLL TTNEHWTPCILNEAEKIIYK LVKLDSLSAYWNVGCCMSYRGSREHIL EQLKREIL

TSTNIPPDHQYI IFQPISASAKLYMNPGAESELKTPKLDGNVEVQNIAIELTKPQ YLSMIDFLESLDYMVRNAPYRKYKPCLPLHTNCRQW WWKYAI

DSVLEVHIRRYTQPWSWSNIKNHRQLLKSYKMAYKTKLTQAKVSEEIQKQIQ DLEKSLDVFNIILVRQQAQVE VIHSGQKLRKKSAEAGEKRGWFSGF

WGKKESKKRDEESSVPET TIDDLMTPEEKDKLFTAIGYSENAYNLALPKQ YVAHILTLKLVSTSIIIRENRNVPEILRVQIIGLGTQVSQRPGAQALK

 KIEAKLEHWYVTGLRQQDIVPSLVASIGDTTSSLLKIEFETNPENSPADQTLIVQSQPVEVIYDA KTINAVVEFFQSNKGLDLEQITSATLMKLEEIK

ERTATG GLTHIIETRKVLDLRINLKPSYLIIPQTGFHHEKSNLLILDFGTFQ LNSKDQGAQKTANASLEEIIDKAYDKFDVEIRSVQLLFAKAE EEN

WKKCRFQHPSTMHILQPMDIHVELAKAMVEKDVRMAK KFKVSGGLPLMHVRISDQKIKDALCLINSIPLPQKSSTPSPERQ VASIPVLSGGTKALLGT

SLLLDGVESE ESDEEFFDAEDGDSQAARTVKASELKKAAEVPNEELVSLLLKFEIKE VVLELTKQQKEEETILVFNVTQLGTEATMRTFDLTAVSYLR

KISLDYHDIKG GSRKKPIHLISSSDRPGLDLLKVEYIK - UNI10165 - VDRNGPSFQTTFEKTEQTVK VAFSSLNLLLQTQALLSSLNYLTTVI

PSDSQNTGVAKEVQAMPEKQKNSPLQKV VMVPSRDSDVIGFRLFAKLNAFCVTVCDEKSNIAEIKIQG GLDSSLSLQSKKQSLFARLENIIVTDVDPK

TIHKK AVSIVGNEVFRFNLDLYPDATEGDSYTDMSTVDGVVALHVGCIQIVYLHKFLMSLL SFLNNFQVAKEALSAATAQAAEKAATSVKDLAQRSFR

VSVDIDLKAPVIVIPQSSLSTNAVVVDLGLIRVHNRFSLVSGEDTANPPVIDKMEVQLTKLKLSR RTAIQPGTSHPDIQLLHPINLEFFVSRNLAANWY

HKVPVVEIKGRLDSMN VSLNQEDLNLLFRILAENLGEATEDLDKGKPRIQERG GETKACREVSTPQDVHTTQGVPAARVEETRPVDIINVLLNFEIKE

 - UNI7253 - VVVTLMKKAERKGSPFHELKILHLGMEAKVKAHDMTAAAYLRNISMRCFHFPD DSKGEPLRIVNTSDVSDGILLKLLFIK ADSDG

PDFKTIHDNTKQKLK VSFSSLDLVLHLEALLSLMDFLSSAIPSSDSSSSEKEPELKPLVGESRSLAIRAV VPSSYEGDAFDLKITAELNAFNIFICDQ

KSNIAEIKIHG GMDASISVKPKQTDVFARLKNIIVMNVDSLSIHKK AVSILGDEVFRFQMSLYPDATEGENYGDMSKVDGRLSLKVGCIQIVYVHKFF

MSLL SFLNNFQAAKEALSTATVQAAERAASSVKDLAQKSFRLLMDIDLKAPVITIPQSSVSPNVVIADLGLIRVENKFSLVSVEQLALPPVADEMSIQL

TQLKLAR RTVLQADSPQHDVEILKPVNMLLCIQRNLSAAWYTQIPGMEIKGELKPMQ VALSQDDLTVLMKILLENLGEASSQPSPTQYAQEAARVKRD

TRSGPDYLKE - UNI9738 - EQELADPKPPGDQTVTLQFDFHFDSLSIILYNSDSSQ - UNI1505 - EPRLSFHNDSFRLGELTLHLMASAGKM

FKDGSMNVSLKLKTCTLDDLREGIERATSR - UNI1119 - RMIDKKNDQDNNSSMIDISYSQDKNGSQVDAVLDKLYVCASVEFLMTVADFFIKAMP

QSPENIAKEIQIPSRQTAAGRVKMEKD DDSVRPNMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLRERRG

KSITT VLQPCSLFMEKCTWASGKQNINIVVKEFVIK ISPIILNTVMTIMAAMSPKTKEDEWKDTPKETDNLWAVKSITDYNSWFLGVDMATEVTENFR

DSEHPSIEENCVVAVESVQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAAAADMTLE VHYYNETHAVWEPLIERVEGNKPWSLKLN VKKNPIQDK

SLMPGDDFIPEPQTAVHISSGATMNITISKSCLNVFSNLAK GFSEGAASTFDYSLKDRAPFTVKNALGVPMKVQPNRNLKVMGSPEKSDIYDVGAGQHL

ELDYASLEPSRQGKLSILSRQESSLFTLTFV - UNI5637 - VPYGYTEVASVPVARPGRRLYNVRNPSASHSDSVLVQIDATEGNKVVTLRSPLQ I

KNHFSIAFIIYKFVKNVKLLERIGIARPEEEFHVPLDSYR RCQLYVQPAGGLEQQYTHSSTYISWKEELHRSREVRCMLQCPAVEVSFLPLIVNTVALP

DELSYIGAHGEDWDPAYVIHLYPPLTLRNLLPYSLRYLLE GTAETHELAEGSSADVLHSRISGEIIELVLVKYLGKNWNGHFRICDTLPEFFLVCFSSD

TAEVMTVDLSVHVRRIGCRMELSVFSPYWLINKTSRVLQYRSEEIHVKHPADFRDIILFSFKKKNIFSKNK VQLKISTSAWSNGFSLDTVGSYGCVKCP

ATNMEYL VGVSIKMSSFNLSRVVTLTPFCTVANKSSLDLEVGEIASDGSIPTNKWHYVASSE CIPFWPENLSGKLCVRVVGYEGSSKPFFYNRQDNGT

LLSLEDL NGGILVDINTAEHSTVITFSDYHEGSAPALIMNHTQWDVLTYKQS SGSQEELVLLPGETRLFAWADPTGIRKLTWNYAANFGEHDLLK - 

UNI9095 - DECGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADHEVALSLHSLGLSLVNNENKQEVSYVGITS SSGVVWEMKP

KQKWKPFSQKQIMSLEQAYSKRLASQDRGWVKLDSNFE VNFDKVPMEMRLPIRCPIKRDFLSGIQVEFKQSPHQRSLRARLYWLQ VDNQLPGTMFPVV

FHPVAPPKSIALDSE EPKPFIDVSVITRFNEYSKVLQFK KYFMVLIQEMALKVDQGFLGAVISLFTPTTDPEAERKR TKLIQQDIDALNTELMESSM

TDMSILSFFEHFHISPVK LHLSLSLGSGGEESDKEKQEMIAIHSVNLLLKSIGATLTDVDDLIFK KLAYYEIRYQFYKRDQLMWSVVRHYSEQ FLKQ

MYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQ GAVQGPEEFAEGLVIGVRSLVGHTVG GGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQ

PKDFGDSLARGGKGFLR GVVGGVTGIITKPVEG GAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQR - UNI1991 - RVAESTEEVS

SLRPPRLIHEDGIIRPYDRQESEGSDLLE QEMGTQE
Transcript ENSMUST00000057972
Sequence
CTCCTCCCTCTCCCGCCTCCTGGTCCCCGCCATGGTGCTGGAGTCGGTGGTCGCTGACTTGCTGAACCGCTTCCTAGGGGACTACGTGGAGAACCTGAAC

AAGTCCCAGCTAAAGCTGGGGATCTGGGGCG GTAATGTGGCTTTGGATAATCTGCAGATAAAAGAAAATGCTCTG AGTGAATTGGACGTTCCTTTCAA

AGTCAAGGCTGGCCAGATTG ATAAATTAACTTTGAAGATTCCTTGGAAAAACCTTTATGGAGAAGCAGTCGTTGCCACGCTAGAAGGATTATACCTGCT

TGTGGTCCCTGGAGCAA GTATTAAGTATGACGCTGAGAAAGAAGAAAAATCCTTGCAGGATATTAAACAGAAAGAACTTTGCCGAATTGAAGAAGCCCT

TCAGAAAGCAGCAGAGAAAG GTGCACACTCAGGGGAGTTCATGTATGGCTTGGAAAACTTGCTTTACAAGGACGTCAAGCCTG GACGTAAGCGTAAAA

AGCACAAAAAACATTTTAAGAAACGTTTTAAAGGTCTTGATCGCTCCAAAG ATAAGCCCAAAGAAGCAAAAAAGGATACATTTCTGGAAAAATTGGCAA

CTCAAGTAATAAAAAATGTTCAAGTGAAAATTACAGACATTCACATTAAATATGAAGATGAT ATCACGGATCCAGAAAGGCCGCTTTCATTTGGTGTCA

CCCTGAGAGAATTTAGTCTGTTG ACAACTAATGAACACTGGACTCCATGCATTTTAAATGAAGCAGAAAAAATTATATATAAG CTCGTGAAGCTGGAC

AGTCTCAGCGCCTATTGGAACGTTGGCTGCTGCATGTCTTACCGTGGATCGAGGGAGCACATCTTG GAGCAACTGAAACGTGAAATTCTTACAAGTACA

AACATCCCCCCAGACCATCAGTACA TTTTCCAGCCAATATCAGCCTCTGCAAAACTCTACATGAATCCTGGTGCAGAATCAGAGCTCAAAACCCCCAAA

CTCGATGGGAACGTAGAGGTGCAGAATATTGCCATCGAGCTGACGAAGCCTCAG TATTTAAGCATGATTGACTTTTTGGAGTCACTGGATTATATGGTT

AGAAATGCACCATACAGGAAGTACAAACCTTGCTTGCCACTTCACACCAACTGTCGGCAATG GTGGAAATATGCTATTGATTCTGTTCTTGAAGTTCAT

ATAAGAAGATATACTCAGCCATGGTCATGGAGTAACATAAAAAACCATAGGCAGTTACTCAAGAGTTACAAAATGGCCTACAAAACCAAGTTAACACAAG

CCAAAGTCTCAGAAGAGATACAGAAACAAATACAG GACTTGGAGAAGAGTCTAGATGTTTTTAACATAATTTTAGTGAGACAACAAGCACAAGTTGAG 

GTCATTCATTCTGGGCAGAAGTTAAGGAAAAAGTCTGCGGAGGCAGGAGAGAAACGTGGCTGGTTTAGTGGGTTTTGGGGCAAGAAGGAATCTAAGAAGA

GAGATGAGGAGTCTTCAGTCCCTGAGA CCATCGATGACCTTATGACTCCAGAGGAGAAGGACAAGCTCTTCACTGCCATTGGGTACAGTGAGAATGCCT

ACAACTTGGCTTTGCCCAAGCAG TATGTGGCCCATATACTGACTCTGAAGTTGGTCAGCACCTCTATTATAATAAGAGAAAACAGGAATGTTCCAGAAA

TCTTGAGAGTCCAGATAATTGGCTTGGGTACCCAAGTCTCCCAGCGACCAGGAGCACAAGCATTGAA GATAGAAGCAAAATTAGAACACTGGTACGTCA

CAGGTTTGCGACAACAAGACATTGTGCCATCACTGGTGGCTTCCATTGGTGACACTACATCGTCCTTGCTCAAAATTGAGTTTGAAACCAACCCTGAGAA

CAGTCCTGCTGACCAGACTCTGATTGTTCAGTCACAGCCCGTGGAGGTCATCTATGACGCT AAAACTATCAATGCTGTTGTTGAATTCTTTCAGTCAAA

TAAGGGGTTGGATCTTGAGCAAATTACATCAGCTACCTTGATGAAACTGGAAGAGATTAAAGAGAGGACAGCTACAG GACTTACGCATATCATTGAGAC

TCGGAAAGTTCTCGATTTAAGGATAAATCTGAAGCCTTCTTACCTGATAATTCCACAGACAGGTTTTCACCATGAAAAGTCAAATCTTCTCATTTTAGAT

TTTGGTACTTTTCAG CTCAACAGTAAAGACCAAGGCGCACAGAAGACTGCTAATGCATCCCTTGAAGAAATAATAGACAAGGCGTATGACAAGTTTGAT

GTGGAGATAAGGAGTGTGCAGTTGCTCTTTGCAAAAGCAG TATTTAAAC TGTCAGGAGGACTGCCTTTGATGCATGTGAGGATTTCTGACCAGAAGAT

AAAGGATGCGCTGTGTTTGATTAACAGTATACCTTTGCCACAGAAGTCATCCACACCGTCTCCAGAGAGACAG GTAGCCTCAATTCCTGTTCTTTCAGG

AGGGACGAAAGCACTTCTTGGGACTTCATTGTTGCTAGATGGAGTGGAATCAG AGTCTGACGAGGAGTTCTTTGATGCTGAGGACGGAGACTCGCAGGC

TGCTAGAACTGTCAAAGCCTCAGAACTGAAAAAAGCTGCTGAAGTTCCAAATGAGGAGCTGGTTAGTCTCCTGCTCAAGTTTGAGATTAAAGAG GTGGT

TTTGGAACTCACTAAACAACAGAAAGAAGAAGAGACAATCCTAGTATTTAATGTCACTCAGTTAGGGACAGAAGCAACAATGAGGACATTTGACCTGACT

GCGGTGTCCTATTTGAGGAAAATCAGCTTGGATTACCATGACATTAAAG GATCCAGAAAGAAGCCAATTCACTTGATTAGCTCTTCAGACAGACCTGGA

CTAGATCTTTTAAAAGTGGAGTACATTAAG - UNI10165 - GTTGATAGGAATGGGCCTAGTTTTCAAACTACTTTTGAGAAAACTGAACAAACTGT

TAAG GTGGCCTTTTCATCTTTGAATCTGTTGCTACAAACGCAAGCTCTTCTGTCTTCTCTTAACTACTTGACAACTGTCATCCCATCAGACAGTCAGAA

CACGGGTGTGGCCAAGGAGGTGCAGGCCATGCCTGAGAAACAAAAGAACTCTCCCCTGCAGAAAG TGATGGTCCCCTCCAGAGATAGTGACGTGATTGG

CTTTAGGCTGTTTGCCAAACTGAATGCTTTCTGTGTCACTGTCTGTGATGAGAAGAGCAATATTGCTGAAATCAAGATACAAG GCCTTGATTCTTCTCT

TTCTCTTCAATCAAAGAAGCAGTCACTTTTTGCCAGGCTGGAAAACATTATTGTCACAGATGTTGATCCCAAAACAATTCATAAGAAA GCTGTATCCAT

AGTTGGGAATGAAGTTTTTCGCTTTAACCTGGATTTGTATCCGGATGCTACTGAAGGGGATTCCTACACTGACATGTCCACAGTGGATGGCGTGGTGGCA

CTGCACGTCGGCTGTATTCAGATTGTCTACCTTCATAAATTCCTTATGTCGCTGCTG AGCTTCCTGAACAATTTCCAGGTGGCCAAGGAGGCGCTGAGT

GCAGCCACTGCCCAGGCTGCGGAAAAGGCGGCCACGAGCGTGAAGGATCTCGCCCAGAGAAGCTTCCGTGTTTCTGTCGATATTGATTTGAAAGCACCCG

TCATTGTCATTCCGCAGTCCTCTCTCTCCACCAATGCTGTTGTGGTGGATCTTGGGCTAATTAGAGTTCACAATCGGTTCAGTCTGGTGTCTGGAGAAGA

CACTGCAAATCCTCCAGTGATCGACAAAATGGAGGTGCAGCTCACGAAACTGAAACTCTCTAG GACAGCAATCCAGCCAGGCACCTCCCACCCTGATAT

TCAGCTGTTGCACCCAATTAACTTGGAGTTTTTTGTAAGTCGGAATCTAGCTGCAAATTGGTACCATAAGGTGCCTGTTGTAGAAATTAAAGGGCGTCTT

GACTCAATGAAT GTTAGTCTAAATCAAGAGGATCTTAATCTTCTGTTTAGAATATTGGCAGAAAATCTTGGCGAGGCCACTGAAGACTTGGATAAAGGG

AAACCTAGAATACAAGAGAGAG GTGAAACAAAAGCCTGCCGAGAAGTCTCTACACCGCAGGATGTGCACACCACACAAGGTGTGCCAGCAGCCAGAGTG

GAGGAGACCAGACCCGTAGACATCATTAATGTACTGTTGAACTTTGAAATTAAAGAG - UNI7253 - GTTGTGGTTACTTTGATGAAAAAAGCAGAA

AGGAAAGGAAGCCCCTTTCATGAACTAAAGATCCTGCATCTTGGGATGGAAGCTAAAGTAAAAGCCCACGACATGACTGCTGCAGCCTACCTCAGGAACA

TTAGCATGCGGTGTTTCCACTTCCCTG ATTCTAAAGGGGAGCCTCTGCGCATTGTCAACACCTCTGATGTGTCTGATGGGATCCTCCTGAAACTGCTGT

TCATCAAG GCAGACAGTGATGGACCAGACTTTAAGACCATTCATGATAACACCAAACAGAAGCTGAAG GTTTCGTTTTCATCCTTGGACTTGGTACTT

CATTTGGAAGCTTTACTTTCCCTCATGGATTTTTTGTCATCTGCTATCCCATCCTCTGACTCTTCTTCCTCTGAGAAGGAACCTGAGCTAAAGCCACTTG

TGGGGGAGTCCAGAAGTCTTGCCATCAGAGCCG TGCCCAGCTCTTATGAGGGTGACGCGTTTGATTTGAAGATCACAGCTGAATTAAATGCCTTTAACA

TCTTCATTTGTGATCAGAAGAGTAACATAGCAGAAATTAAAATACATG GAATGGATGCCTCGATTTCTGTGAAGCCAAAGCAGACTGATGTATTTGCCA

GACTTAAGAATATCATAGTTATGAATGTTGATTCACTGTCCATTCACAAAAAG GCTGTCTCTATTTTGGGAGATGAAGTCTTCCGGTTCCAGATGAGTC

TGTATCCAGATGCCACAGAAGGAGAGAATTATGGCGATATGTCTAAAGTGGATGGCAGACTTAGTCTCAAAGTGGGCTGTATTCAGATTGTCTATGTTCA

TAAATTCTTTATGTCTCTCTTG AGCTTCCTCAACAATTTCCAAGCTGCCAAGGAAGCCTTGAGCACAGCCACAGTCCAGGCTGCAGAGAGAGCTGCGTC

CAGTGTGAAGGACCTGGCCCAGAAGAGCTTCCGGCTTCTGATGGACATCGATTTGAAAGCACCTGTCATCACTATTCCCCAGTCTTCTGTGTCACCAAAT

GTCGTTATAGCAGATCTGGGCTTGATCAGAGTTGAGAACAAGTTTAGCTTGGTTTCTGTGGAGCAGCTCGCGCTTCCCCCAGTGGCCGACGAGATGAGCA

TCCAGCTCACCCAGCTGAAGCTTGCCAG AACTGTTTTACAAGCTGATTCACCTCAGCATGACGTTGAAATCTTAAAACCTGTGAACATGCTTTTATGCA

TACAGCGGAATTTGTCAGCAGCGTGGTACACACAGATTCCAGGCATGGAGATAAAAGGCGAACTTAAACCTATGCAG GTTGCTCTCAGTCAAGATGACT

TGACAGTTTTAATGAAAATTTTGCTGGAAAACCTTGGGGAAGCTTCTTCACAACCAAGCCCTACACAGTATGCACAGGAGGCTGCACGGGTGAAGAGAGA

TACTCGGAGTGGGCCTGACTATCTTAAAG - UNI9738 - AACAAGAGCTGGCGGACCCAAAGCCGCCCGGGGACCAGACCGTCACTCTTCAGTTTGA

TTTCCACTTTGACTCTCTTTCCATCATCCTTTACAACAGTGATAGCAGCCAG - UNI1505 - GAGCCCAGGCTTTCATTTCACAATGACAGTTTCCG

TTTGGGTGAGCTCACACTACACCTGATGGCTTCTGCTGGGAAGATGTTCAAGGATGGGTCTATGAATGTCAGCCTTAAACTTAAGACGTGCACGCTTGAT

GATCTCCGAGAAGGAATCGAGAGAGCCACCTCCAG - UNI1119 - GATGATTGACAAAAAGAATGACCAGGACAACAACAGCTCTATGATTGATATA

AGTTATAGCCAGGATAAAAATGGAAGCCAGGTCGATGCTGTCCTTGACAAGCTGTACGTGTGTGCCAGTGTGGAGTTTCTGATGACCGTGGCTGATTTCT

TCATCAAAGCTATGCCTCAGAGTCCAGAAAACATAGCCAAAGAAATACAGATTCCATCAAGACAGACTGCCGCGGGAAGAGTCAAGATGGAGAAAG ATG

ACTCTGTGAGGCCAAATATGACTCTGAAGGCCATGATCACAGACCCAGAAGTGGTGTTTGTTGCCAGCCTGACTAAGGCCGATGCTCCCGCTCTCACGGC

CTCCTTCCAGTGCAACCTCTCCCTCTCAACGTCCAAACTGGAGCAGATGATGGAAGCTTCTGTGAGAGACCTGAAAGTGCTGGCCTGCCCTTTCCTCAGA

GAAAGGAGAGGAAAGAGCATCACCACG GTGTTGCAACCTTGCTCCTTATTTATGGAAAAGTGCACATGGGCTTCCGGGAAACAAAACATCAATATTGTG

GTTAAAGAGTTTGTGATTAAG ATCTCACCTATAATCCTTAATACTGTAATGACAATCATGGCTGCTATGTCTCCAAAGACCAAAGAAGATGAATGGAAA

GACACTCCTAAGGAGACAGACAATCTCTGGGCTGTCAAATCTATTACTGATTATAACTCTTGGTTTCTCGGGGTTGACATGGCAACAGAAGTAACAGAAA

ATTTTAGAGACTCTGAACATCCATCGATAGAGGAAAATTGTGTGGTTGCTGTGGAGTCAGTTCAAGTCACCTTAGAGTGTGGCCTAGGGCATCGCACTGT

GCCCCTGTTATTGGCAGAGTCCAAGTTCTCTGGAAATATTAAAAACTGGACTTCTCTAATGGCCGCTGCTGCTGACATGACACTAGAG GTTCACTATTA

CAATGAAACTCATGCCGTCTGGGAGCCACTGATTGAAAGAGTGGAGGGGAACAAGCCGTGGAGCTTAAAGCTTAAT GTAAAGAAAAACCCGATCCAGGA

TAAAAGTTTGATGCCAGGAGATGACTTTATTCCTGAGCCACAAACAGCAGTTCATATTTCTTCAGGAGCTACGATGAATATCACAATATCCAAAAGCTGT

CTTAATGTTTTCAGCAATTTAGCAAAA GGTTTCTCCGAGGGAGCGGCTTCTACGTTTGACTACTCTCTGAAAGACAGGGCTCCTTTTACAGTCAAAAAT

GCGCTGGGTGTCCCCATGAAGGTGCAGCCCAATCGTAACCTCAAGGTCATGGGCTCCCCTGAGAAGAGTGACATTTATGACGTGGGCGCTGGTCAGCACT

TGGAGCTGGACTACGCCAGCCTGGAACCTTCGCGCCAAGGGAAGCTGTCCATCCTGAGCCGGCAGGAGAGCTCGCTCTTCACACTGACCTTTG - UNI5

637 - TACCATATGGTTATACAGAAGTAGCTAGTGTTCCTGTCGCCAGGCCTGGCCGACGATTGTATAATGTGCGGAACCCCAGTGCCAGCCATTCGGA

TTCCGTGTTGGTGCAGATTGACGCAACAGAAGGCAATAAGGTTGTCACTCTTCGCTCACCTCTGCAG ATTAAAAACCACTTCTCAATAGCATTTATCAT

CTACAAATTTGTCAAGAATGTTAAGCTGTTGGAGCGCATCGGAATAGCCAGACCTGAGGAAGAGTTCCATGTTCCTCTGGATTCCTATAG GTGCCAGTT

GTATGTTCAGCCGGCTGGCGGCTTGGAGCAGCAGTACACACACTCCTCCACCTACATTTCCTGGAAGGAGGAGCTTCACCGCAGCAGGGAGGTCAGGTGC

ATGCTGCAGTGTCCTGCAGTGGAAGTCAGCTTCCTACCCCTCATCGTGAACACGGTCGCTCTGCCCGATGAGCTGAGTTACATCGGTGCCCACGGGGAAG

ACTGGGATCCAGCCTACGTCATTCATCTTTACCCTCCTCTCACCTTGCGGAACCTTCTCCCGTATTCGCTAAGATACTTACTTGAG GGAACCGCAGAAA

CCCACGAGCTGGCAGAAGGCAGTTCTGCTGACGTCCTTCACTCACGGATCAGTGGCGAGATCATAGAGCTCGTCCTGGTGAAATACCTGGGCAAGAACTG

GAACGGACACTTCCGCATCTGTGACACACTTCCCGAGTTCTTCCTCGTGTGCTTTTCCTCAGACACTGCAGAAGTGATGACAGTTGACCTGTCAGTTCAC

GTCAGGCGGATTGGCTGCCGAATGGAGCTGTCTGTCTTTAGTCCCTATTGGCTAATCAACAAAACTTCTCGGGTTCTCCAGTATCGCTCTGAGGAGATAC

ATGTTAAACACCCAGCTGATTTCAGGGACATCATTTTATTCTCTTTCAAGAAGAAGAACATTTTTAGTAAAAACAAG GTACAGCTAAAAATTTCAACCA

GTGCCTGGTCCAATGGTTTCTCACTGGACACTGTGGGCAGTTACGGGTGTGTGAAGTGCCCGGCCACCAATATGGAATACCTG GTCGGGGTTAGCATCA

AGATGAGCAGTTTTAATCTCTCACGAGTAGTCACTCTGACTCCCTTCTGTACTGTTGCAAATAAGTCCTCGTTAGACCTAGAAGTTGGAGAGATTGCTTC

AGATGGTTCCATACCCACCAACAAATGGCACTATGTTGCTTCGTCAGAG TGTATTCCATTTTGGCCTGAAAATTTGTCTGGCAAACTTTGTGTGAGAGT

GGTGGGCTACGAAGGCTCTTCCAAGCCATTCTTTTACAACCGACAAGACAACGGCACTTTATTGAGCTTAGAGGATCTG AATGGAGGCATCCTGGTGGA

CATAAACACTGCTGAACACTCAACTGTCATAACCTTCAGTGACTATCATGAGGGGTCTGCGCCTGCTCTGATAATGAACCACACACAGTGGGATGTCCTC

ACGTATAAACAGAG TGGGTCACAGGAGGAACTAGTATTGCTGCCAGGAGAAACTCGACTCTTTGCCTGGGCAGATCCCACTGGCATCAGGAAACTCACT

TGGAACTATGCAGCTAACTTTGGGGAGCATGATCTCTTAAAG - UNI9095 - GATGAGTGTGGTCAGTTTCCGTACGATGCGAACATCCAGATACAC

TGGGTGTCCTTCCTTGATGGGCGCCAGAGGGTTCTGCTTTTCACAGATGATGTTGCTTTGGTTTCCAAAGCACTCCAAGCTGAAGAAATGGAACAGGCCG

ATCACGAAGTAGCCTTGTCGCTCCACAGCCTCGGGCTCTCTCTGGTTAACAATGAAAACAAGCAGGAAGTCTCATATGTCGGAATCACCAG CTCAGGTG

TTGTTTGGGAGATGAAGCCAAAACAGAAATGGAAGCCGTTTAGTCAGAAGCAGATAATGTCCCTGGAGCAGGCCTATTCGAAGCGCCTTGCATCACAAGA

CCGCGGCTGGGTCAAGCTGGACAGTAATTTTGAG GTCAATTTTGACAAAGTGCCGATGGAAATGCGCCTCCCTATCCGGTGCCCTATTAAACGGGACTT

CTTATCAGGGATTCAGGTTGAGTTTAAGCAGTCTCCTCACCAGAGAAGCCTAAGGGCCCGGTTGTATTGGCTCCAG GTCGATAATCAGTTACCAGGCAC

AATGTTCCCAGTTGTATTTCACCCTGTGGCTCCTCCTAAGTCCATTGCTTTGGATTCAG AGCCCAAGCCTTTCATCGATGTGAGTGTAATTACGAGGTT

CAATGAGTACAGTAAAGTCTTACAGTTCAA GTATTTTATGGTTCTCATCCAGGAAATGGCCTTAAAGGTTGATCAGGGCTTCCTTGGAGCTGTTATTTC

ACTGTTTACTCCCACAACTGATCCTGAGGCTGAAAGAAAACGG ACAAAGTTAATCCAACAAGATATTGATGCTCTCAACACAGAGTTGATGGAGTCTTC

AATGACTGATATGTCAATCCTGAGTTTCTTTGAACATTTCCACATTTCCCCTGTTAAG TTGCATCTGAGTCTGTCTTTGGGATCCGGAGGTGAGGAATC

AGACAAAGAGAAACAGGAAATGATTGCAATTCATTCTGTGAACCTGCTGTTGAAGAGCATAGGTGCCACTCTGACGGACGTGGATGACCTCATATTCAA 

GCTTGCTTACTATGAGATTCGCTATCAGTTTTACAAGAGAGATCAGCTCATGTGGAGTGTTGTCAGACACTACAGTGAACAG TTCTTGAAGCAGATGTA

TGTGCTTGTATTGGGCTTAGACGTGCTTGGAAACCCATTTGGACTGATTAGGGGCCTGTCCGAAGGAGTTGAAGCACTGTTCTATGAGCCCTTCCAG GG

TGCTGTCCAAGGTCCTGAAGAATTTGCTGAAGGATTAGTGATTGGGGTGAGAAGTCTCGTTGGACACACAGTAG GTGGTGCAGCGGGAGTCGTATCTCG

AATCACTGGGTCAGTTGGGAAAGGCCTGGCCGCAATTACAATGGACAAAGAGTATCAGCAGAAGAGAAGAGAGGAGATGGGGCGACAGCCTAAAGATTTT

GGAGACAGTCTTGCCAGAGGAGGGAAGGGCTTCCTGCGT GGAGTTGTTGGTGGGGTGACTGGAATAATAACAAAGCCCGTGGAAG GTGCCAAGAAGGA

GGGCGCTGCCGGCTTCTTTAAAGGAATTGGAAAAGGGCTTGTGGGTGCCGTGGCTCGTCCAACTGGCGGGATCATAGATATGGCTAGCAGCACCTTCCAA

GGCATTCAGAG - UNI1991 - GGTAGCAGAATCCACTGAGGAGGTGTCCAGCCTCCGTCCACCTCGTCTGATCCACGAAGACGGTATCATTCGTCCA

TATGACAGGCAGGAATCGGAGGGTTCCGACCTATTAGAG AATCACATCAAGAAGTTGGAGGGCGAGGCCTACCAGTTCCACTGTGCCGTTCCCGGGAAC

AAGAGGGCTGTCCTTATGATCACAAACAG GCGAGCACTGTTTATAAAGGAGGTTGAAATCCTAGGCCATATGTCTGTGGACTGGCAGTGTCTGTTTGAA

GATTTTGTATGTCCTCCTGAAGTCAGTGAAAATCTGCTGAAGATTTCAGTTAAG GAGCAGGGTCTGTTCCATAAAAAAGACAGTGCCAATATAGGCCAT

CTTCGGAAAATTTACCTGAAGGATCCCATCACAGCCAAG AGGGCCTTTGATGCCATTGAGAGCGCCCAGTCAGCAAGGCAGCAGCAGAAGCTCATGAGG

CAGTCGTCAGTGAAACTCCTCAGGCCCCAGGGGCCGTCTTGACCATGGATTCTACAAGGCTTCTGAGGGGGAAGCGGCCGCTGCAGGGCCTGCTCAAGAG

AACATTTCCAGCGATTCCTTGGCTCTGGGTTTTGGTGTTTTGTTTTGTTTTTTGTTTTTGACTCTTAATTTTGAGTCTTGGGAATTCTGCATATATTAGG

AATCTACTGCTACACGTTTAGGTCAGACCTCAAAGAAATACCACTTCAGCTTGGAGAGACTTATTCATTAATATTAAAATTGTGAAG
Translation
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGG GNVALDNLQIKENAL SELDVPFKVKAGQID DKLTLKIPWKNLYGEAVVATLEGLYLLVVPGAS

 SIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKG GAHSGEFMYGLENLLYKDVKPG GRKRKKHKKHFKKRFKGLDRSKD DKPKEAKKDTFLEKLA

TQVIKNVQVKITDIHIKYEDD ITDPERPLSFGVTLREFSLL TTNEHWTPCILNEAEKIIYK LVKLDSLSAYWNVGCCMSYRGSREHIL EQLKREIL

TSTNIPPDHQYI IFQPISASAKLYMNPGAESELKTPKLDGNVEVQNIAIELTKPQ YLSMIDFLESLDYMVRNAPYRKYKPCLPLHTNCRQW WWKYAI

DSVLEVHIRRYTQPWSWSNIKNHRQLLKSYKMAYKTKLTQAKVSEEIQKQIQ DLEKSLDVFNIILVRQQAQVE VIHSGQKLRKKSAEAGEKRGWFSGF

WGKKESKKRDEESSVPET TIDDLMTPEEKDKLFTAIGYSENAYNLALPKQ YVAHILTLKLVSTSIIIRENRNVPEILRVQIIGLGTQVSQRPGAQALK

 KIEAKLEHWYVTGLRQQDIVPSLVASIGDTTSSLLKIEFETNPENSPADQTLIVQSQPVEVIYDA KTINAVVEFFQSNKGLDLEQITSATLMKLEEIK

ERTATG GLTHIIETRKVLDLRINLKPSYLIIPQTGFHHEKSNLLILDFGTFQ LNSKDQGAQKTANASLEEIIDKAYDKFDVEIRSVQLLFAKAV VFK

L LSGGLPLMHVRISDQKIKDALCLINSIPLPQKSSTPSPERQ VASIPVLSGGTKALLGTSLLLDGVESE ESDEEFFDAEDGDSQAARTVKASELKKA

AEVPNEELVSLLLKFEIKE VVLELTKQQKEEETILVFNVTQLGTEATMRTFDLTAVSYLRKISLDYHDIKG GSRKKPIHLISSSDRPGLDLLKVEYIK

 - UNI10165 - VDRNGPSFQTTFEKTEQTVK VAFSSLNLLLQTQALLSSLNYLTTVIPSDSQNTGVAKEVQAMPEKQKNSPLQKV VMVPSRDSDV

IGFRLFAKLNAFCVTVCDEKSNIAEIKIQG GLDSSLSLQSKKQSLFARLENIIVTDVDPKTIHKK AVSIVGNEVFRFNLDLYPDATEGDSYTDMSTVD

GVVALHVGCIQIVYLHKFLMSLL SFLNNFQVAKEALSAATAQAAEKAATSVKDLAQRSFRVSVDIDLKAPVIVIPQSSLSTNAVVVDLGLIRVHNRFSL

VSGEDTANPPVIDKMEVQLTKLKLSR RTAIQPGTSHPDIQLLHPINLEFFVSRNLAANWYHKVPVVEIKGRLDSMN VSLNQEDLNLLFRILAENLGEA

TEDLDKGKPRIQERG GETKACREVSTPQDVHTTQGVPAARVEETRPVDIINVLLNFEIKE - UNI7253 - VVVTLMKKAERKGSPFHELKILHLGM

EAKVKAHDMTAAAYLRNISMRCFHFPD DSKGEPLRIVNTSDVSDGILLKLLFIK ADSDGPDFKTIHDNTKQKLK VSFSSLDLVLHLEALLSLMDFLS

SAIPSSDSSSSEKEPELKPLVGESRSLAIRAV VPSSYEGDAFDLKITAELNAFNIFICDQKSNIAEIKIHG GMDASISVKPKQTDVFARLKNIIVMNV

DSLSIHKK AVSILGDEVFRFQMSLYPDATEGENYGDMSKVDGRLSLKVGCIQIVYVHKFFMSLL SFLNNFQAAKEALSTATVQAAERAASSVKDLAQK

SFRLLMDIDLKAPVITIPQSSVSPNVVIADLGLIRVENKFSLVSVEQLALPPVADEMSIQLTQLKLAR RTVLQADSPQHDVEILKPVNMLLCIQRNLSA

AWYTQIPGMEIKGELKPMQ VALSQDDLTVLMKILLENLGEASSQPSPTQYAQEAARVKRDTRSGPDYLKE - UNI9738 - EQELADPKPPGDQTVT

LQFDFHFDSLSIILYNSDSSQ - UNI1505 - EPRLSFHNDSFRLGELTLHLMASAGKMFKDGSMNVSLKLKTCTLDDLREGIERATSR - UNI111

9 - RMIDKKNDQDNNSSMIDISYSQDKNGSQVDAVLDKLYVCASVEFLMTVADFFIKAMPQSPENIAKEIQIPSRQTAAGRVKMEKD DDSVRPNMTLK

AMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLRERRGKSITT VLQPCSLFMEKCTWASGKQNINIVVKEFVIK I

SPIILNTVMTIMAAMSPKTKEDEWKDTPKETDNLWAVKSITDYNSWFLGVDMATEVTENFRDSEHPSIEENCVVAVESVQVTLECGLGHRTVPLLLAESK

FSGNIKNWTSLMAAAADMTLE VHYYNETHAVWEPLIERVEGNKPWSLKLN VKKNPIQDKSLMPGDDFIPEPQTAVHISSGATMNITISKSCLNVFSNL

AK GFSEGAASTFDYSLKDRAPFTVKNALGVPMKVQPNRNLKVMGSPEKSDIYDVGAGQHLELDYASLEPSRQGKLSILSRQESSLFTLTFV - UNI56

37 - VPYGYTEVASVPVARPGRRLYNVRNPSASHSDSVLVQIDATEGNKVVTLRSPLQ IKNHFSIAFIIYKFVKNVKLLERIGIARPEEEFHVPLDSY

R RCQLYVQPAGGLEQQYTHSSTYISWKEELHRSREVRCMLQCPAVEVSFLPLIVNTVALPDELSYIGAHGEDWDPAYVIHLYPPLTLRNLLPYSLRYLL

E GTAETHELAEGSSADVLHSRISGEIIELVLVKYLGKNWNGHFRICDTLPEFFLVCFSSDTAEVMTVDLSVHVRRIGCRMELSVFSPYWLINKTSRVLQ

YRSEEIHVKHPADFRDIILFSFKKKNIFSKNK VQLKISTSAWSNGFSLDTVGSYGCVKCPATNMEYL VGVSIKMSSFNLSRVVTLTPFCTVANKSSLD

LEVGEIASDGSIPTNKWHYVASSE CIPFWPENLSGKLCVRVVGYEGSSKPFFYNRQDNGTLLSLEDL NGGILVDINTAEHSTVITFSDYHEGSAPALI

MNHTQWDVLTYKQS SGSQEELVLLPGETRLFAWADPTGIRKLTWNYAANFGEHDLLK - UNI9095 - DECGQFPYDANIQIHWVSFLDGRQRVLLF

TDDVALVSKALQAEEMEQADHEVALSLHSLGLSLVNNENKQEVSYVGITS SSGVVWEMKPKQKWKPFSQKQIMSLEQAYSKRLASQDRGWVKLDSNFE 

VNFDKVPMEMRLPIRCPIKRDFLSGIQVEFKQSPHQRSLRARLYWLQ VDNQLPGTMFPVVFHPVAPPKSIALDSE EPKPFIDVSVITRFNEYSKVLQF

K KYFMVLIQEMALKVDQGFLGAVISLFTPTTDPEAERKR TKLIQQDIDALNTELMESSMTDMSILSFFEHFHISPVK LHLSLSLGSGGEESDKEKQE

MIAIHSVNLLLKSIGATLTDVDDLIFK KLAYYEIRYQFYKRDQLMWSVVRHYSEQ FLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQ GAVQ

GPEEFAEGLVIGVRSLVGHTVG GGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQPKDFGDSLARGGKGFLR GVVGGVTGIITKPVEG GAKK

EGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQR - UNI1991 - RVAESTEEVSSLRPPRLIHEDGIIRPYDRQESEGSDLLE NHIKKLEGE

AYQFHCAVPGNKRAVLMITNR RRALFIKEVEILGHMSVDWQCLFEDFVCPPEVSENLLKISVK EQGLFHKKDSANIGHLRKIYLKDPITAK RAFDAI

ESAQSARQQQKLMRQSSVKLLRPQGPS
Transcript ENSMUST00000077879
Sequence
CTCCTCCCTCTCCCGCCTCCTGGTCCCCGCCATGGTGCTGGAGTCGGTGGTCGCTGACTTGCTGAACCGCTTCCTAGGGGACTACGTGGAGAACCTGAAC

AAGTCCCAGCTAAAGCTGGGGATCTGGGGCG GTAATGTGGCTTTGGATAATCTGCAGATAAAAGAAAATGCTCTG AGTGAATTGGACGTTCCTTTCAA

AGTCAAGGCTGGCCAGATTG ATAAATTAACTTTGAAGATTCCTTGGAAAAACCTTTATGGAGAAGCAGTCGTTGCCACGCTAGAAGGATTATACCTGCT

TGTGGTCCCTGGAGCAA GTATTAAGTATGACGCTGAGAAAGAAGAAAAATCCTTGCAGGATATTAAACAGAAAGAACTTTGCCGAATTGAAGAAGCCCT

TCAGAAAGCAGCAGAGAAAG GTGCACACTCAGGGGAGTTCATGTATGGCTTGGAAAACTTGCTTTACAAGGACGTCAAGCCTG GACGTAAGCGTAAAA

AGCACAAAAAACATTTTAAGAAACGTTTTAAAGGTCTTGATCGCTCCAAAG ATAAGCCCAAAGAAGCAAAAAAGGATACATTTCTGGAAAAATTGGCAA

CTCAAGTAATAAAAAATGTTCAAGTGAAAATTACAGACATTCACATTAAATATGAAGATGAT ATCACGGATCCAGAAAGGCCGCTTTCATTTGGTGTCA

CCCTGAGAGAATTTAGTCTGTTG ACAACTAATGAACACTGGACTCCATGCATTTTAAATGAAGCAGAAAAAATTATATATAAG CTCGTGAAGCTGGAC

AGTCTCAGCGCCTATTGGAACGTTGGCTGCTGCATGTCTTACCGTGGATCGAGGGAGCACATCTTG GAGCAACTGAAACGTGAAATTCTTACAAGTACA

AACATCCCCCCAGACCATCAGTACA TTTTCCAGCCAATATCAGCCTCTGCAAAACTCTACATGAATCCTGGTGCAGAATCAGAGCTCAAAACCCCCAAA

CTCGATGGGAACGTAGAGGTGCAGAATATTGCCATCGAGCTGACGAAGCCTCAG TATTTAAGCATGATTGACTTTTTGGAGTCACTGGATTATATGGTT

AGAAATGCACCATACAGGAAGTACAAACCTTGCTTGCCACTTCACACCAACTGTCGGCAATG GTGGAAATATGCTATTGATTCTGTTCTTGAAGTTCAT

ATAAGAAGATATACTCAGCCATGGTCATGGAGTAACATAAAAAACCATAGGCAGTTACTCAAGAGTTACAAAATGGCCTACAAAACCAAGTTAACACAAG

CCAAAGTCTCAGAAGAGATACAGAAACAAATACAG GACTTGGAGAAGAGTCTAGATGTTTTTAACATAATTTTAGTGAGACAACAAGCACAAGTTGAG 

GTCATTCATTCTGGGCAGAAGTTAAGGAAAAAGTCTGCGGAGGCAGGAGAGAAACGTGGCTGGTTTAGTGGGTTTTGGGGCAAGAAGGAATCTAAGAAGA

GAGATGAGGAGTCTTCAGTCCCTGAGA CCATCGATGACCTTATGACTCCAGAGGAGAAGGACAAGCTCTTCACTGCCATTGGGTACAGTGAGAATGCCT

ACAACTTGGCTTTGCCCAAGCAG TATGTGGCCCATATACTGACTCTGAAGTTGGTCAGCACCTCTATTATAATAAGAGAAAACAGGAATGTTCCAGAAA

TCTTGAGAGTCCAGATAATTGGCTTGGGTACCCAAGTCTCCCAGCGACCAGGAGCACAAGCATTGAA GATAGAAGCAAAATTAGAACACTGGTACGTCA

CAGGTTTGCGACAACAAGACATTGTGCCATCACTGGTGGCTTCCATTGGTGACACTACATCGTCCTTGCTCAAAATTGAGTTTGAAACCAACCCTGAGAA

CAGTCCTGCTGACCAGACTCTGATTGTTCAGTCACAGCCCGTGGAGGTCATCTATGACGCT AAAACTATCAATGCTGTTGTTGAATTCTTTCAGTCAAA

TAAGGGGTTGGATCTTGAGCAAATTACATCAGCTACCTTGATGAAACTGGAAGAGATTAAAGAGAGGACAGCTACAG GACTTACGCATATCATTGAGAC

TCGGAAAGTTCTCGATTTAAGGATAAATCTGAAGCCTTCTTACCTGATAATTCCACAGACAGGTTTTCACCATGAAAAGTCAAATCTTCTCATTTTAGAT

TTTGGTACTTTTCAG CTCAACAGTAAAGACCAAGGCGCACAGAAGACTGCTAATGCATCCCTTGAAGAAATAATAGACAAGGCGTATGACAAGTTTGAT

GTGGAGATAAGGAGTGTGCAGTTGCTCTTTGCAAAAGCAG AGGAAAATTGGAAAAAGTGTAGATTCCAGCATCCATCGACTATGCATATACTGCAGCCA

ATGGATATTCACGTTGAGTTGGCCAAGGCAATGGTGGAGAAGGATGTTAGAATGGCCAA ATTTAAAGTGTCAGGAGGACTGCCTTTGATGCATGTGAGG

ATTTCTGACCAGAAGATAAAGGATGCGCTGTGTTTGATTAACAGTATACCTTTGCCACAGAAGTCATCCACACCGTCTCCAGAGAGACAG GTAGCCTCA

ATTCCTGTTCTTTCAGGAGGGACGAAAGCACTTCTTGGGACTTCATTGTTGCTAGATGGAGTGGAATCAG AGTCTGACGAGGAGTTCTTTGATGCTGAG

GACGGAGACTCGCAGGCTGCTAGAACTGTCAAAGCCTCAGAACTGAAAAAAGCTGCTGAAGTTCCAAATGAGGAGCTGGTTAGTCTCCTGCTCAAGTTTG

AGATTAAAGAG GTGGTTTTGGAACTCACTAAACAACAGAAAGAAGAAGAGACAATCCTAGTATTTAATGTCACTCAGTTAGGGACAGAAGCAACAATGA

GGACATTTGACCTGACTGCGGTGTCCTATTTGAGGAAAATCAGCTTGGATTACCATGACATTAAAG GATCCAGAAAGAAGCCAATTCACTTGATTAGCT

CTTCAGACAGACCTGGACTAGATCTTTTAAAAGTGGAGTACATTAAG - UNI10165 - GTTGATAGGAATGGGCCTAGTTTTCAAACTACTTTTGAG

AAAACTGAACAAACTGTTAAG GTGGCCTTTTCATCTTTGAATCTGTTGCTACAAACGCAAGCTCTTCTGTCTTCTCTTAACTACTTGACAACTGTCATC

CCATCAGACAGTCAGAACACGGGTGTGGCCAAGGAGGTGCAGGCCATGCCTGAGAAACAAAAGAACTCTCCCCTGCAGAAAG TGATGGTCCCCTCCAGA

GATAGTGACGTGATTGGCTTTAGGCTGTTTGCCAAACTGAATGCTTTCTGTGTCACTGTCTGTGATGAGAAGAGCAATATTGCTGAAATCAAGATACAAG

 GCCTTGATTCTTCTCTTTCTCTTCAATCAAAGAAGCAGTCACTTTTTGCCAGGCTGGAAAACATTATTGTCACAGATGTTGATCCCAAAACAATTCATA

AGAAA GCTGTATCCATAGTTGGGAATGAAGTTTTTCGCTTTAACCTGGATTTGTATCCGGATGCTACTGAAGGGGATTCCTACACTGACATGTCCACAG

TGGATGGCGTGGTGGCACTGCACGTCGGCTGTATTCAGATTGTCTACCTTCATAAATTCCTTATGTCGCTGCTG AGCTTCCTGAACAATTTCCAGGTGG

CCAAGGAGGCGCTGAGTGCAGCCACTGCCCAGGCTGCGGAAAAGGCGGCCACGAGCGTGAAGGATCTCGCCCAGAGAAGCTTCCGTGTTTCTGTCGATAT

TGATTTGAAAGCACCCGTCATTGTCATTCCGCAGTCCTCTCTCTCCACCAATGCTGTTGTGGTGGATCTTGGGCTAATTAGAGTTCACAATCGGTTCAGT

CTGGTGTCTGGAGAAGACACTGCAAATCCTCCAGTGATCGACAAAATGGAGGTGCAGCTCACGAAACTGAAACTCTCTAG GACAGCAATCCAGCCAGGC

ACCTCCCACCCTGATATTCAGCTGTTGCACCCAATTAACTTGGAGTTTTTTGTAAGTCGGAATCTAGCTGCAAATTGGTACCATAAGGTGCCTGTTGTAG

AAATTAAAGGGCGTCTTGACTCAATGAAT GTTAGTCTAAATCAAGAGGATCTTAATCTTCTGTTTAGAATATTGGCAGAAAATCTTGGCGAGGCCACTG

AAGACTTGGATAAAGGGAAACCTAGAATACAAGAGAGAG GTGAAACAAAAGCCTGCCGAGAAGTCTCTACACCGCAGGATGTGCACACCACACAAGGTG

TGCCAGCAGCCAGAGTGGAGGAGACCAGACCCGTAGACATCATTAATGTACTGTTGAACTTTGAAATTAAAGAG - UNI7253 - GTTGTGGTTACTT

TGATGAAAAAAGCAGAAAGGAAAGGAAGCCCCTTTCATGAACTAAAGATCCTGCATCTTGGGATGGAAGCTAAAGTAAAAGCCCACGACATGACTGCTGC

AGCCTACCTCAGGAACATTAGCATGCGGTGTTTCCACTTCCCTG ATTCTAAAGGGGAGCCTCTGCGCATTGTCAACACCTCTGATGTGTCTGATGGGAT

CCTCCTGAAACTGCTGTTCATCAAG GCAGACAGTGATGGACCAGACTTTAAGACCATTCATGATAACACCAAACAGAAGCTGAAG GTTTCGTTTTCAT

CCTTGGACTTGGTACTTCATTTGGAAGCTTTACTTTCCCTCATGGATTTTTTGTCATCTGCTATCCCATCCTCTGACTCTTCTTCCTCTGAGAAGGAACC

TGAGCTAAAGCCACTTGTGGGGGAGTCCAGAAGTCTTGCCATCAGAGCCG TGCCCAGCTCTTATGAGGGTGACGCGTTTGATTTGAAGATCACAGCTGA

ATTAAATGCCTTTAACATCTTCATTTGTGATCAGAAGAGTAACATAGCAGAAATTAAAATACATG GAATGGATGCCTCGATTTCTGTGAAGCCAAAGCA

GACTGATGTATTTGCCAGACTTAAGAATATCATAGTTATGAATGTTGATTCACTGTCCATTCACAAAAAG GCTGTCTCTATTTTGGGAGATGAAGTCTT

CCGGTTCCAGATGAGTCTGTATCCAGATGCCACAGAAGGAGAGAATTATGGCGATATGTCTAAAGTGGATGGCAGACTTAGTCTCAAAGTGGGCTGTATT

CAGATTGTCTATGTTCATAAATTCTTTATGTCTCTCTTG AGCTTCCTCAACAATTTCCAAGCTGCCAAGGAAGCCTTGAGCACAGCCACAGTCCAGGCT

GCAGAGAGAGCTGCGTCCAGTGTGAAGGACCTGGCCCAGAAGAGCTTCCGGCTTCTGATGGACATCGATTTGAAAGCACCTGTCATCACTATTCCCCAGT

CTTCTGTGTCACCAAATGTCGTTATAGCAGATCTGGGCTTGATCAGAGTTGAGAACAAGTTTAGCTTGGTTTCTGTGGAGCAGCTCGCGCTTCCCCCAGT

GGCCGACGAGATGAGCATCCAGCTCACCCAGCTGAAGCTTGCCAG AACTGTTTTACAAGCTGATTCACCTCAGCATGACGTTGAAATCTTAAAACCTGT

GAACATGCTTTTATGCATACAGCGGAATTTGTCAGCAGCGTGGTACACACAGATTCCAGGCATGGAGATAAAAGGCGAACTTAAACCTATGCAG GTTGC

TCTCAGTCAAGATGACTTGACAGTTTTAATGAAAATTTTGCTGGAAAACCTTGGGGAAGCTTCTTCACAACCAAGCCCTACACAGTATGCACAGGAGGCT

GCACGGGTGAAGAGAGATACTCGGAGTGGGCCTGACTATCTTAAAG - UNI9738 - AACAAGAGCTGGCGGACCCAAAGCCGCCCGGGGACCAGACC

GTCACTCTTCAGTTTGATTTCCACTTTGACTCTCTTTCCATCATCCTTTACAACAGTGATAGCAGCCAG - UNI1505 - GAGCCCAGGCTTTCATTT

CACAATGACAGTTTCCGTTTGGGTGAGCTCACACTACACCTGATGGCTTCTGCTGGGAAGATGTTCAAGGATGGGTCTATGAATGTCAGCCTTAAACTTA

AGACGTGCACGCTTGATGATCTCCGAGAAGGAATCGAGAGAGCCACCTCCAG - UNI1119 - GATGATTGACAAAAAGAATGACCAGGACAACAACA

GCTCTATGATTGATATAAGTTATAGCCAGGATAAAAATGGAAGCCAGGTCGATGCTGTCCTTGACAAGCTGTACGTGTGTGCCAGTGTGGAGTTTCTGAT

GACCGTGGCTGATTTCTTCATCAAAGCTATGCCTCAGAGTCCAGAAAACATAGCCAAAGAAATACAGATTCCATCAAGACAGACTGCCGCGGGAAGAGTC

AAGATGGAGAAAG ATGACTCTGTGAGGCCAAATATGACTCTGAAGGCCATGATCACAGACCCAGAAGTGGTGTTTGTTGCCAGCCTGACTAAGGCCGAT

GCTCCCGCTCTCACGGCCTCCTTCCAGTGCAACCTCTCCCTCTCAACGTCCAAACTGGAGCAGATGATGGAAGCTTCTGTGAGAGACCTGAAAGTGCTGG

CCTGCCCTTTCCTCAGAGAAAGGAGAGGAAAGAGCATCACCACG GTGTTGCAACCTTGCTCCTTATTTATGGAAAAGTGCACATGGGCTTCCGGGAAAC

AAAACATCAATATTGTGGTTAAAGAGTTTGTGATTAAG ATCTCACCTATAATCCTTAATACTGTAATGACAATCATGGCTGCTATGTCTCCAAAGACCA

AAGAAGATGAATGGAAAGACACTCCTAAGGAGACAGACAATCTCTGGGCTGTCAAATCTATTACTGATTATAACTCTTGGTTTCTCGGGGTTGACATGGC

AACAGAAGTAACAGAAAATTTTAGAGACTCTGAACATCCATCGATAGAGGAAAATTGTGTGGTTGCTGTGGAGTCAGTTCAAGTCACCTTAGAGTGTGGC

CTAGGGCATCGCACTGTGCCCCTGTTATTGGCAGAGTCCAAGTTCTCTGGAAATATTAAAAACTGGACTTCTCTAATGGCCGCTGCTGCTGACATGACAC

TAGAG GTTCACTATTACAATGAAACTCATGCCGTCTGGGAGCCACTGATTGAAAGAGTGGAGGGGAACAAGCCGTGGAGCTTAAAGCTTAAT GTAAAG

AAAAACCCGATCCAGGATAAAAGTTTGATGCCAGGAGATGACTTTATTCCTGAGCCACAAACAGCAGTTCATATTTCTTCAGGAGCTACGATGAATATCA

CAATATCCAAAAGCTGTCTTAATGTTTTCAGCAATTTAGCAAAA GGTTTCTCCGAGGGAGCGGCTTCTACGTTTGACTACTCTCTGAAAGACAGGGCTC

CTTTTACAGTCAAAAATGCGCTGGGTGTCCCCATGAAGGTGCAGCCCAATCGTAACCTCAAGGTCATGGGCTCCCCTGAGAAGAGTGACATTTATGACGT

GGGCGCTGGTCAGCACTTGGAGCTGGACTACGCCAGCCTGGAACCTTCGCGCCAAGGGAAGCTGTCCATCCTGAGCCGGCAGGAGAGCTCGCTCTTCACA

CTGACCTTTG - UNI5637 - TACCATATGGTTATACAGAAGTAGCTAGTGTTCCTGTCGCCAGGCCTGGCCGACGATTGTATAATGTGCGGAACCCC

AGTGCCAGCCATTCGGATTCCGTGTTGGTGCAGATTGACGCAACAGAAGGCAATAAGGTTGTCACTCTTCGCTCACCTCTGCAG ATTAAAAACCACTTC

TCAATAGCATTTATCATCTACAAATTTGTCAAGAATGTTAAGCTGTTGGAGCGCATCGGAATAGCCAGACCTGAGGAAGAGTTCCATGTTCCTCTGGATT

CCTATAG GTGCCAGTTGTATGTTCAGCCGGCTGGCGGCTTGGAGCAGCAGTACACACACTCCTCCACCTACATTTCCTGGAAGGAGGAGCTTCACCGCA

GCAGGGAGGTCAGGTGCATGCTGCAGTGTCCTGCAGTGGAAGTCAGCTTCCTACCCCTCATCGTGAACACGGTCGCTCTGCCCGATGAGCTGAGTTACAT

CGGTGCCCACGGGGAAGACTGGGATCCAGCCTACGTCATTCATCTTTACCCTCCTCTCACCTTGCGGAACCTTCTCCCGTATTCGCTAAGATACTTACTT

GAG GGAACCGCAGAAACCCACGAGCTGGCAGAAGGCAGTTCTGCTGACGTCCTTCACTCACGGATCAGTGGCGAGATCATAGAGCTCGTCCTGGTGAAA

TACCTGGGCAAGAACTGGAACGGACACTTCCGCATCTGTGACACACTTCCCGAGTTCTTCCTCGTGTGCTTTTCCTCAGACACTGCAGAAGTGATGACAG

TTGACCTGTCAGTTCACGTCAGGCGGATTGGCTGCCGAATGGAGCTGTCTGTCTTTAGTCCCTATTGGCTAATCAACAAAACTTCTCGGGTTCTCCAGTA

TCGCTCTGAGGAGATACATGTTAAACACCCAGCTGATTTCAGGGACATCATTTTATTCTCTTTCAAGAAGAAGAACATTTTTAGTAAAAACAAG GTACA

GCTAAAAATTTCAACCAGTGCCTGGTCCAATGGTTTCTCACTGGACACTGTGGGCAGTTACGGGTGTGTGAAGTGCCCGGCCACCAATATGGAATACCTG

 GTCGGGGTTAGCATCAAGATGAGCAGTTTTAATCTCTCACGAGTAGTCACTCTGACTCCCTTCTGTACTGTTGCAAATAAGTCCTCGTTAGACCTAGAA

GTTGGAGAGATTGCTTCAGATGGTTCCATACCCACCAACAAATGGCACTATGTTGCTTCGTCAGAG TGTATTCCATTTTGGCCTGAAAATTTGTCTGGC

AAACTTTGTGTGAGAGTGGTGGGCTACGAAGGCTCTTCCAAGCCATTCTTTTACAACCGACAAGACAACGGCACTTTATTGAGCTTAGAGGATCTG AAT

GGAGGCATCCTGGTGGACATAAACACTGCTGAACACTCAACTGTCATAACCTTCAGTGACTATCATGAGGGGTCTGCGCCTGCTCTGATAATGAACCACA

CACAGTGGGATGTCCTCACGTATAAACAGAG TGGGTCACAGGAGGAACTAGTATTGCTGCCAGGAGAAACTCGACTCTTTGCCTGGGCAGATCCCACTG

GCATCAGGAAACTCACTTGGAACTATGCAGCTAACTTTGGGGAGCATGATCTCTTAAAG - UNI9095 - GATGAGTGTGGTCAGTTTCCGTACGATG

CGAACATCCAGATACACTGGGTGTCCTTCCTTGATGGGCGCCAGAGGGTTCTGCTTTTCACAGATGATGTTGCTTTGGTTTCCAAAGCACTCCAAGCTGA

AGAAATGGAACAGGCCGATCACGAAGTAGCCTTGTCGCTCCACAGCCTCGGGCTCTCTCTGGTTAACAATGAAAACAAGCAGGAAGTCTCATATGTCGGA

ATCACCAG CTCAGGTGTTGTTTGGGAGATGAAGCCAAAACAGAAATGGAAGCCGTTTAGTCAGAAGCAGATAATGTCCCTGGAGCAGGCCTATTCGAAG

CGCCTTGCATCACAAGACCGCGGCTGGGTCAAGCTGGACAGTAATTTTGAG GTCAATTTTGACAAAGTGCCGATGGAAATGCGCCTCCCTATCCGGTGC

CCTATTAAACGGGACTTCTTATCAGGGATTCAGGTTGAGTTTAAGCAGTCTCCTCACCAGAGAAGCCTAAGGGCCCGGTTGTATTGGCTCCAG GTCGAT

AATCAGTTACCAGGCACAATGTTCCCAGTTGTATTTCACCCTGTGGCTCCTCCTAAGTCCATTGCTTTGGATTCAG AGCCCAAGCCTTTCATCGATGTG

AGTGTAATTACGAGGTTCAATGAGTACAGTAAAGTCTTACAGTTCAA GTATTTTATGGTTCTCATCCAGGAAATGGCCTTAAAGGTTGATCAGGGCTTC

CTTGGAGCTGTTATTTCACTGTTTACTCCCACAACTGATCCTGAGGCTGAAAGAAAACGG ACAAAGTTAATCCAACAAGATATTGATGCTCTCAACACA

GAGTTGATGGAGTCTTCAATGACTGATATGTCAATCCTGAGTTTCTTTGAACATTTCCACATTTCCCCTGTTAAG TTGCATCTGAGTCTGTCTTTGGGA

TCCGGAGGTGAGGAATCAGACAAAGAGAAACAGGAAATGATTGCAATTCATTCTGTGAACCTGCTGTTGAAGAGCATAGGTGCCACTCTGACGGACGTGG

ATGACCTCATATTCAA GCTTGCTTACTATGAGATTCGCTATCAGTTTTACAAGAGAGATCAGCTCATGTGGAGTGTTGTCAGACACTACAGTGAACAG 

TTCTTGAAGCAGATGTATGTGCTTGTATTGGGCTTAGACGTGCTTGGAAACCCATTTGGACTGATTAGGGGCCTGTCCGAAGGAGTTGAAGCACTGTTCT

ATGAGCCCTTCCAG GGTGCTGTCCAAGGTCCTGAAGAATTTGCTGAAGGATTAGTGATTGGGGTGAGAAGTCTCGTTGGACACACAGTAG GTGGTGCA

GCGGGAGTCGTATCTCGAATCACTGGGTCAGTTGGGAAAGGCCTGGCCGCAATTACAATGGACAAAGAGTATCAGCAGAAGAGAAGAGAGGAGATGGGGC

GACAGCCTAAAGATTTTGGAGACAGTCTTGCCAGAGGAGGGAAGGGCTTCCTGCGT GGAGTTGTTGGTGGGGTGACTGGAATAATAACAAAGCCCGTGG

AAG GTGCCAAGAAGGAGGGCGCTGCCGGCTTCTTTAAAGGAATTGGAAAAGGGCTTGTGGGTGCCGTGGCTCGTCCAACTGGCGGGATCATAGATATGG

CTAGCAGCACCTTCCAAGGCATTCAGAG - UNI1991 - GGTAGCAGAATCCACTGAGGAGGTGTCCAGCCTCCGTCCACCTCGTCTGATCCACGAAG

ACGGTATCATTCGTCCATATGACAGGCAGGAATCGGAGGGTTCCGACCTATTAGAG AATCACATCAAGAAGTTGGAGGGCGAGGCCTACCAGTTCCACT

GTGCCGTTCCCGGGAACAAGAGGGCTGTCCTTATGATCACAAACAG GCGAGCACTGTTTATAAAGGAGGTTGAAATCCTAGGCCATATGTCTGTGGACT

GGCAGTGTCTGTTTGAAGATTTTGTATGTCCTCCTGAAGTCAGTGAAAATCTGCTGAAGATTTCAGTTAAG GAGCAGGGTCTGTTCCATAAAAAAGACA

GTGCCAATATAGGCCATCTTCGGAAAATTTACCTGAAGGATCCCATCACAGCCAAG AGGGCCTTTGATGCCATTGAGAGCGCCCAGTCAGCAAGGCAGC

AGCAGAAGCTCATGAGGCAGTCGTCAGTGAAACTCCTCAGGCCCCAGGGGCCGTCTTGACCATGGATTCTACAAGGCTTCTGAGGGGGAAGCGGCCGCTG

CAGGGCCTGCTCAAGAGAACATTTCCAGCGATTCCTTGGCTCTGGGTTTTGGTGTTTTGTTTTGTTTTTTGTTTTTGACTCTTAATTTTGAGTCTTGGGA

ATTCTGCATATATTAGGAATCTACTGCTACACGTTTAGGTCAGACCTCAAAGAAATACCACTTCAGCTTGGAGAGACTTATTCATTAATATTAAAATTGT

GAAG
Translation
MVLESVVADLLNRFLGDYVENLNKSQLKLGIWGG GNVALDNLQIKENAL SELDVPFKVKAGQID DKLTLKIPWKNLYGEAVVATLEGLYLLVVPGAS

 SIKYDAEKEEKSLQDIKQKELCRIEEALQKAAEKG GAHSGEFMYGLENLLYKDVKPG GRKRKKHKKHFKKRFKGLDRSKD DKPKEAKKDTFLEKLA

TQVIKNVQVKITDIHIKYEDD ITDPERPLSFGVTLREFSLL TTNEHWTPCILNEAEKIIYK LVKLDSLSAYWNVGCCMSYRGSREHIL EQLKREIL

TSTNIPPDHQYI IFQPISASAKLYMNPGAESELKTPKLDGNVEVQNIAIELTKPQ YLSMIDFLESLDYMVRNAPYRKYKPCLPLHTNCRQW WWKYAI

DSVLEVHIRRYTQPWSWSNIKNHRQLLKSYKMAYKTKLTQAKVSEEIQKQIQ DLEKSLDVFNIILVRQQAQVE VIHSGQKLRKKSAEAGEKRGWFSGF

WGKKESKKRDEESSVPET TIDDLMTPEEKDKLFTAIGYSENAYNLALPKQ YVAHILTLKLVSTSIIIRENRNVPEILRVQIIGLGTQVSQRPGAQALK

 KIEAKLEHWYVTGLRQQDIVPSLVASIGDTTSSLLKIEFETNPENSPADQTLIVQSQPVEVIYDA KTINAVVEFFQSNKGLDLEQITSATLMKLEEIK

ERTATG GLTHIIETRKVLDLRINLKPSYLIIPQTGFHHEKSNLLILDFGTFQ LNSKDQGAQKTANASLEEIIDKAYDKFDVEIRSVQLLFAKAE EEN

WKKCRFQHPSTMHILQPMDIHVELAKAMVEKDVRMAK KFKVSGGLPLMHVRISDQKIKDALCLINSIPLPQKSSTPSPERQ VASIPVLSGGTKALLGT

SLLLDGVESE ESDEEFFDAEDGDSQAARTVKASELKKAAEVPNEELVSLLLKFEIKE VVLELTKQQKEEETILVFNVTQLGTEATMRTFDLTAVSYLR

KISLDYHDIKG GSRKKPIHLISSSDRPGLDLLKVEYIK - UNI10165 - VDRNGPSFQTTFEKTEQTVK VAFSSLNLLLQTQALLSSLNYLTTVI

PSDSQNTGVAKEVQAMPEKQKNSPLQKV VMVPSRDSDVIGFRLFAKLNAFCVTVCDEKSNIAEIKIQG GLDSSLSLQSKKQSLFARLENIIVTDVDPK

TIHKK AVSIVGNEVFRFNLDLYPDATEGDSYTDMSTVDGVVALHVGCIQIVYLHKFLMSLL SFLNNFQVAKEALSAATAQAAEKAATSVKDLAQRSFR

VSVDIDLKAPVIVIPQSSLSTNAVVVDLGLIRVHNRFSLVSGEDTANPPVIDKMEVQLTKLKLSR RTAIQPGTSHPDIQLLHPINLEFFVSRNLAANWY

HKVPVVEIKGRLDSMN VSLNQEDLNLLFRILAENLGEATEDLDKGKPRIQERG GETKACREVSTPQDVHTTQGVPAARVEETRPVDIINVLLNFEIKE

 - UNI7253 - VVVTLMKKAERKGSPFHELKILHLGMEAKVKAHDMTAAAYLRNISMRCFHFPD DSKGEPLRIVNTSDVSDGILLKLLFIK ADSDG

PDFKTIHDNTKQKLK VSFSSLDLVLHLEALLSLMDFLSSAIPSSDSSSSEKEPELKPLVGESRSLAIRAV VPSSYEGDAFDLKITAELNAFNIFICDQ

KSNIAEIKIHG GMDASISVKPKQTDVFARLKNIIVMNVDSLSIHKK AVSILGDEVFRFQMSLYPDATEGENYGDMSKVDGRLSLKVGCIQIVYVHKFF

MSLL SFLNNFQAAKEALSTATVQAAERAASSVKDLAQKSFRLLMDIDLKAPVITIPQSSVSPNVVIADLGLIRVENKFSLVSVEQLALPPVADEMSIQL

TQLKLAR RTVLQADSPQHDVEILKPVNMLLCIQRNLSAAWYTQIPGMEIKGELKPMQ VALSQDDLTVLMKILLENLGEASSQPSPTQYAQEAARVKRD

TRSGPDYLKE - UNI9738 - EQELADPKPPGDQTVTLQFDFHFDSLSIILYNSDSSQ - UNI1505 - EPRLSFHNDSFRLGELTLHLMASAGKM

FKDGSMNVSLKLKTCTLDDLREGIERATSR - UNI1119 - RMIDKKNDQDNNSSMIDISYSQDKNGSQVDAVLDKLYVCASVEFLMTVADFFIKAMP

QSPENIAKEIQIPSRQTAAGRVKMEKD DDSVRPNMTLKAMITDPEVVFVASLTKADAPALTASFQCNLSLSTSKLEQMMEASVRDLKVLACPFLRERRG

KSITT VLQPCSLFMEKCTWASGKQNINIVVKEFVIK ISPIILNTVMTIMAAMSPKTKEDEWKDTPKETDNLWAVKSITDYNSWFLGVDMATEVTENFR

DSEHPSIEENCVVAVESVQVTLECGLGHRTVPLLLAESKFSGNIKNWTSLMAAAADMTLE VHYYNETHAVWEPLIERVEGNKPWSLKLN VKKNPIQDK

SLMPGDDFIPEPQTAVHISSGATMNITISKSCLNVFSNLAK GFSEGAASTFDYSLKDRAPFTVKNALGVPMKVQPNRNLKVMGSPEKSDIYDVGAGQHL

ELDYASLEPSRQGKLSILSRQESSLFTLTFV - UNI5637 - VPYGYTEVASVPVARPGRRLYNVRNPSASHSDSVLVQIDATEGNKVVTLRSPLQ I

KNHFSIAFIIYKFVKNVKLLERIGIARPEEEFHVPLDSYR RCQLYVQPAGGLEQQYTHSSTYISWKEELHRSREVRCMLQCPAVEVSFLPLIVNTVALP

DELSYIGAHGEDWDPAYVIHLYPPLTLRNLLPYSLRYLLE GTAETHELAEGSSADVLHSRISGEIIELVLVKYLGKNWNGHFRICDTLPEFFLVCFSSD

TAEVMTVDLSVHVRRIGCRMELSVFSPYWLINKTSRVLQYRSEEIHVKHPADFRDIILFSFKKKNIFSKNK VQLKISTSAWSNGFSLDTVGSYGCVKCP

ATNMEYL VGVSIKMSSFNLSRVVTLTPFCTVANKSSLDLEVGEIASDGSIPTNKWHYVASSE CIPFWPENLSGKLCVRVVGYEGSSKPFFYNRQDNGT

LLSLEDL NGGILVDINTAEHSTVITFSDYHEGSAPALIMNHTQWDVLTYKQS SGSQEELVLLPGETRLFAWADPTGIRKLTWNYAANFGEHDLLK - 

UNI9095 - DECGQFPYDANIQIHWVSFLDGRQRVLLFTDDVALVSKALQAEEMEQADHEVALSLHSLGLSLVNNENKQEVSYVGITS SSGVVWEMKP

KQKWKPFSQKQIMSLEQAYSKRLASQDRGWVKLDSNFE VNFDKVPMEMRLPIRCPIKRDFLSGIQVEFKQSPHQRSLRARLYWLQ VDNQLPGTMFPVV

FHPVAPPKSIALDSE EPKPFIDVSVITRFNEYSKVLQFK KYFMVLIQEMALKVDQGFLGAVISLFTPTTDPEAERKR TKLIQQDIDALNTELMESSM

TDMSILSFFEHFHISPVK LHLSLSLGSGGEESDKEKQEMIAIHSVNLLLKSIGATLTDVDDLIFK KLAYYEIRYQFYKRDQLMWSVVRHYSEQ FLKQ

MYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQ GAVQGPEEFAEGLVIGVRSLVGHTVG GGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQ

PKDFGDSLARGGKGFLR GVVGGVTGIITKPVEG GAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQR - UNI1991 - RVAESTEEVS

SLRPPRLIHEDGIIRPYDRQESEGSDLLE NHIKKLEGEAYQFHCAVPGNKRAVLMITNR RRALFIKEVEILGHMSVDWQCLFEDFVCPPEVSENLLKI

SVK EQGLFHKKDSANIGHLRKIYLKDPITAK RAFDAIESAQSARQQQKLMRQSSVKLLRPQGPS

For any suggestions or comments, please send an email to unitrap@crg.es