Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035365 (4930547N16Rik)
Chromosomal location
Chr 10: 87554790 - 87609649 (-)
Description
RIKEN cDNA 4930547N16 gene Gene [Source:MGI Symbol;Acc:MGI:1922567]
RefSeq_dna
NM_029249 
RefSeq_peptide
NP_083525.1 
UniGene
Mm.179378 
MGI
MGI:1922567 
Uniprot/SWISSPROT
Q6IRT3 
Human Ortholog
ENSG00000185480 (C12orf48)
Omim not available
UniTrap UNI21573
Vector Insertion
Chr 10: 87606841 - 87609240
Public Clones not available
Private Clones OST325567 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048518
Sequence
CTGGCTGCGCTGCTCCTCCCTCCGCTTGCACCCAGCCTGGGTCACTGGACGAGGTGGGTCTGGTCTCTTCTGTGCCCCCGGGTCGCAGTTCCAGTGGGCA

TTCGGGCTGCTGCTCTGCGAACGCATCTCGGTGACAGCGACGTGCCAGCCAGTGGCGTTGTCTGCGCAGTGGCTTCGCCCCGACTTCACGGTGTCCCGTG

GAAAAAAAGACGCTAGGGCTTCGGCAAGACCGAAACCCATCAAAATCTTCTTTTAGTCCGTTAGATCGGGGATCTGGCACACGACGAGTGCAGGCTTCTC

AGATTTTCTGTCGTTGCATCCTTCAGAGGGCCATTCCGGACCAGGCAAGAAGAATAACTGTCACCTGTCATCTTTTAATGGAGATTTGCTAAGTGCTGGC

AATAAGGAG - UNI21573 - AGGATGGCTGTGCTTAATCAGCTGCCCGTCTTGGGTATGATTAAAGAGTTTAGGAGGAGTTGGCGTGCTCTTTGTAG

CTCTGAAAGAACTACGTTATGCGGTCCAGACTCCATGCTCCTGGCCCTGCAGCTGTCCATGGCAGAAAACAACAAACAG CACAGAGGAGAATTTACAGT

CTGTCTCAGTGATGTCTTACTGACATGGAAGTACTTCTTACACGAGAAACTGAACTTGCCCATTGAAAATATGAAAGTGGTTGAGCACTATGAAGACATT

AAGAAAACATATGATGATTTCTTGAAGAACAGTAATACACTAGATCTGATTGATGTTTATAAAAAATGTAGCAGCTTGACCTCTAATTATGAGAATAACA

TGATTTCCCCT ATTCAACTCCGGGATTTTCTGTCTGGCACAGAGTATGCAGTCAGTGACGAAGCTAATCCTCACATGCCAGAGTCACCAGTAAAATGCA

GCCAGAATGACGAGCAG GTACGGGTATTGGTAAAGAAAATTTTCTTTTCATATTTGAGCCTGCTAGTGAATTCAAAGAATGACCTGGCTTTGGCTTCCA

TTCTCAACATCCCTGATCGAGGACTGGGGAGAGAGGCCTTCACCAACTTGAAGCATGCTGCTCGAGAGAAACAGTTGTCTATGTTTCTG ATGGCCACGT

CATTTATCAGGACATTGGAACTTGGAGGAAAAGGATATGCGCCGTCACCATCAGATCCTCTGTGGGCGCATGTAAAAGGCCTGTCGGAGTTTATTAATTT

CATTGACAAGCTAGATGAAATTCTTGGAAAGATACCAAATCCAAG CCTTGCAGGGAGTCGGATATTATCAGCGATAAAGATGCAGCTGATCAAAGGCCA

CAGCAGTGGGGAGCCTTTTTATAAAGCAGTAGAGGAAGTTGTTCAGGATTTGAATTTGAGGATTAAAAATATTATTAATTCTCAAGAAGGTGTAGCTGTC

AGCGCCAACAACATCAGTCCTGTCCCG CCAAAATCTTTTGCTATAAACCATGATACTGCCTACTGTGGCAGAGATGCTGTGAAAATTTTGCTGGTCCTT

TTGGATGAAGATGCAGCCAGTGCTCCTACCAGAAATAAAGCAGAGCTTTTATACAATGACGAAAGTACAGTTCCTCATAGTGGACCATCTGTTCTCACAC

TCTTTAG GTCTCCCACACAAGAGAAAAACACATCAGTTAAACCTCTCAGAGAGCGAATCCATAAGTCACTGCAAACAGAGAAAAATAAG ATGTGGCAG

ACATTAATTAGATCACAGTTTGCTTGTACTTATAAAGATGACTGCATAATGAGCAAGAATAAATGGCATGTTAACTCATCATCAAAGCCCTTGTCTGCTC

TTCACTTGGAAGATGATGTTTCTG AGGGAGCACAGTCATCTGTTGGAAAAGCAAGAATTGAAGCAAGTTCTGAAAATGCCCACGTGGGCAGATGGAAGG

GTGACAAACTACCAAGAAAATCTACACAAAGGCAGATATCGAAGAGGAAACAGCTGGACTTAGACAGTGAGAATCTTCACTGTGACCGTGGAAATGAACT

GTACCAACATAAGAACATTAAGATCCCTAAAGTGCCCAGTGGCTCACACAGTAAAGCTGGTGGCAAACTTGCCCAAGGAACAAAAGGCAATAGGTGTCCT

GCCAGGGGCAAGTTGATTCCTGGCCAGACCAAGTTGACGCAGTTTTTTATGCTATGATTTTGCCGACTATGTACTTTAGATTTCAGTAAGACCATTCACC

AAAGCCCTGAACTAACTTTTTAAATCTTAAGATATGTTGTGGTTTTTTTTTTGTTTGTTTTTTTTAGTGAACGCTTTCACCTTTGTTTCTCAATATTCGT

GTGATACGAACAGTTCACATGTAGCATTGTTTAGTGACTTGTGTGAGTTTTATACCCAGACCTGGGTGGAATGAAGGATAAAGACATTTATTTAGCCCAG

CTTCCAACAAATCAAAGAGGGTGCCCAGAAGGTCCTCACCCACACTTCAGTGCCCTGTATCCCTGGGAGGACAACGACTCCGTAAAGCGTAAGGAGGGGC

GAAGAGCTCTGGTTCTTGAGGTCCAGTGGGTTATTACATCGTTTCCCAAGATGTCCCATGTGATGCTTTATTATTTTCATAAATGTATGTGAGGCTCACA

TATTAACCACTGTTCAAAAATACCAGTAAGGCAGAATTATGCAGAACTTTTGTGAGGTTTAATGCACACGTCAAGCATATCGCTTACATTATTACATATC

TTAACCAGGTCCTTTTAAAACAGACATTTACATAATGCACAAGTTATAGCAACATCAAGGGCTTTTCTCCCCGCTTGCAATGAATTGTTTTCTTCTGTAA

GGATGTTGCGGACCAGCAGGTATCAGACTTGCCAACATGGTCGGTAGACTCTTCCCAGCATACACCTGAGCACTGAAAGAGAACAAACAATGACTATAAA

TACCATGCAGAATTGAGAAAAACTGTGGACTTACAACGAATCCAGAATAAATCAAACTCTATTACTG
Translation
 - UNI21573 - MAVLNQLPVLGMIKEFRRSWRALCSSERTTLCGPDSMLLALQLSMAENNKQ HRGEFTVCLSDVLLTWKYFLHEKLNLPIENMKVV

EHYEDIKKTYDDFLKNSNTLDLIDVYKKCSSLTSNYENNMISP IQLRDFLSGTEYAVSDEANPHMPESPVKCSQNDEQ VRVLVKKIFFSYLSLLVNSK

NDLALASILNIPDRGLGREAFTNLKHAAREKQLSMFL MATSFIRTLELGGKGYAPSPSDPLWAHVKGLSEFINFIDKLDEILGKIPNPS SLAGSRILS

AIKMQLIKGHSSGEPFYKAVEEVVQDLNLRIKNIINSQEGVAVSANNISPVP PKSFAINHDTAYCGRDAVKILLVLLDEDAASAPTRNKAELLYNDEST

VPHSGPSVLTLFR RSPTQEKNTSVKPLRERIHKSLQTEKNK MWQTLIRSQFACTYKDDCIMSKNKWHVNSSSKPLSALHLEDDVSE EGAQSSVGKAR

IEASSENAHVGRWKGDKLPRKSTQRQISKRKQLDLDSENLHCDRGNELYQHKNIKIPKVPSGSHSKAGGKLAQGTKGNRCPARGKLIPGQTKLTQFFML

For any suggestions or comments, please send an email to unitrap@crg.es