Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035372 (1810055G02Rik)
Chromosomal location
Chr 19: 3708333 - 3717881 (+)
Description
RIKEN cDNA 1810055G02 gene Gene [Source:MGI Symbol;Acc:MGI:1919306]
RefSeq_peptide
NP_082353.1 
UniGene
Mm.23780 
MGI
MGI:1919306 
Uniprot/SWISSPROT
Q9D8N1 
Human Ortholog
ENSG00000171067 (C11orf24)
Omim not available
UniTrap UNI12501
Vector Insertion
Chr 19: 3708437 - 3714403
Public Clones (sanger) D185A02 (ggtc) W172B01 (ggtc) IST10115A6 (tigm) IST14464E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039048
Sequence
GAGCTGAGCTAACTGGGTTTCGCTGCGGTCCACGTCCCCGCGCGGGGCTGAATCGCTGAAGTGGCTGCGCTGCGGTGTGAGGGCCACGGGCCTGCCGCGT

CCGG - UNI12501 - CAGTGTTGCCTCTCTCAACCGTAGCTGTTTCTGATACCACAGAGGGGCATCTGCCTCTGTCCCACCTGTGCCTTGGCGAATG

CCATGGCCTGGGAGTGCCCTGCCCAGCCGCTCTCATCTGCAAAGCCAGACTTCATATGGCAAGGACAGGATGCCAAGGCCCCAGCTGCTCAAGGAGGACA

TCAGCCTGGCCTCCCAGTCTGCACTGAGCAGCTGTCGCTG ATCCCTGGGCCGAGCAGAAGGCGATTGCTGACAGCCTGAAGGGCTGTCTGGCCAAGACA

CTCAGCCCTGCTTCCAACTCACCCAGCAAGATGTGGACAGCCCTGGTGCTGGTGTGGATTTCCTCTGTGCTCTTACCTAGAAGCCATATGATGTCTGCAG

AGCCAC GAAACATAGTCACTAACAAGTGGCCTAAAGCAGTAAATCAAAGCATGCTGAGGGACACAGTTCCAAGGACTGATAATACATTTACCGAGAGAA

CAGCCATAGTGCCACCTGCTCCTGTCACATTGACAACAGAGACCTGGGCAGCCACCCTGAACTCTACCAGAGTGACAGCAGAGGTGACAACACACGGAAC

AAACACGAGCACTCCAACAACCAGAGAGGGGACAACAGACAGGGTGACCTCCAGAACTCTGGCTGTACCTACATCCTCGGGCCCCTCATCTGCAGAGCAG

ACTAGACCCACCACCATTGCTGGGCTCCCCTCCCTCAGCACACCACATGCAGAAGTGCCAAGAACAAATGCCAGCGTGTCACCAAGAACAGCCATGGCAG

CAACTGTGGCCCCCCACACGGCGACTCTTGCTGCAGGCACCGTAAACACAAGTGATCCTCACACAAGGACTCCGAGTCCTGCCAAAAGCACACCCACTGA

CACATCCAGCAAGAACCCCATACCCACCTCAGGTGCCCAAATACAAGGTACCACCGTCCAGCTGACCACAGACCAGCCAGTGCATAGCACAGCAGGTAGA

TCAGCACTTAGTCCCTCAAACGCCACCCTGGAGCCCACCACCACCCAGGTACAAACCAAGGAGCCATCTGCCAGCACAGTGCCAGCGCGTGCTACCAGCC

TGAGCCCTGATGTAGACGTCATATCCCCCACCACACAGCCAAGCCCTACATTACCTACCCAGGGCACAGGTGGGCCAGGTACACTCCTGACAACAGAGCA

GGTGGGGACCAAAACCACATCTGGTACTGCCTCTGCTGGGCCAACATCCAGGAGCTCAGGGGACATTAAGGTACCAACCACAGACTCGTGCCAGCCTAGC

ACCCAAGGCCAGTACCTAGTCACCATTGATGCCCTGACCCCATCCTTGGTGAACAAGATGTTACTTCTGGTGGTGCTCCTTGTTGGGGTGACCCTCTTCA

TCGCAGTCCTGGTGATGTTTGCCCTGCAAGCCTATGAGAGCTACAAGAAGAAGGACTACACGCAGGTGGACTACCTGATCAATGGCATGTATGCCGACTC

AGAGATGTGAGGGCTTCTCGGGAGGCCAGCCTCTACCATGGCCGCCTGTTTTGCCTCAGACCAAACTAAGTGCTTCCAGATCCTTTCGGTGCAATTTCAG

AGCTGTGCCAGATGCTAGACACATTTAATAGCTGTCAGATCAGCTCATGATCATATCATGAGAAAACCGCCTTTTCATATTTATTTTTCTAACTGATCAC

ATACGCAGGAGTGGCCATGGTCGAGAGGGCCTGACACACTTGGCCCTCGATGTATGAAATCTTGACCAGAATTAAAAGCAAAGACGTCTCTCCTGTCC
Translation
 - UNI12501 -  MWTALVLVWISSVLLPRSHMMSAEPR RNIVTNKWPKAVNQSMLRDTVPRTDNTFTERTAIVPPAPVTLTTETWAATLNSTRVTA

EVTTHGTNTSTPTTREGTTDRVTSRTLAVPTSSGPSSAEQTRPTTIAGLPSLSTPHAEVPRTNASVSPRTAMAATVAPHTATLAAGTVNTSDPHTRTPSP

AKSTPTDTSSKNPIPTSGAQIQGTTVQLTTDQPVHSTAGRSALSPSNATLEPTTTQVQTKEPSASTVPARATSLSPDVDVISPTTQPSPTLPTQGTGGPG

TLLTTEQVGTKTTSGTASAGPTSRSSGDIKVPTTDSCQPSTQGQYLVTIDALTPSLVNKMLLLVVLLVGVTLFIAVLVMFALQAYESYKKKDYTQVDYLI

NGMYADSEM

For any suggestions or comments, please send an email to unitrap@crg.es