Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035390 (Brsk1)
Chromosomal location
Chr 7: 4642206 - 4667598 (+)
Description
BR serine/threonine kinase 1 Gene [Source:MGI (curated);Acc:Brsk1-002]
RefSeq_dna
NM_001003920 
RefSeq_peptide
NP_001003920.2 
UniGene
Mm.297064 
MGI
MGI:2685946 
Uniprot/SWISSPROT
Q5RJI5 
Uniprot/SPTREMBL
A7LH90 A7LH91 
Human Ortholog
ENSG00000160469 (BRSK1)
Omim not available
UniTrap UNI23004
Vector Insertion
Chr 7: 4642818 - 4644255
Public Clones not available
Private Clones OST279134 (lexicon) OST252856 (lexicon) OST131963 (lexicon) OST96468 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13139
Vector Insertion
Chr 7: 4644568 - 4646275
Public Clones CMHD-GT_327A5-3 (cmhd)
Private Clones OST287242 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27177
Vector Insertion
Chr 7: 4646417 - 4650301
Public Clones not available
Private Clones OST67749 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15694
Vector Insertion
Chr 7: 4650709 - 4655729
Public Clones (ggtc) PST3998-NL (escells) IST11164F8 (tigm) IST14725A10 (tigm) IST10597F3 (tigm)
IST13709F9 (tigm) IST14411A12 (tigm) IST13515F9 (tigm) IST14725G10 (tigm)
IST15093C3 (tigm) IST11403A9 (tigm) IST14654C3 (tigm) IST13472F4 (tigm)
IST11861B7 (tigm) IST10256C4 (tigm)
Private Clones OST443305 (lexicon) OST427382 (lexicon) OST412578 (lexicon) OST411826 (lexicon)
OST390532 (lexicon) OST374364 (lexicon) OST373783 (lexicon) OST267390 (lexicon)
OST251097 (lexicon) OST244008 (lexicon) OST211085 (lexicon) OST199082 (lexicon)
OST170126 (lexicon) OST165802 (lexicon) OST157829 (lexicon) OST133902 (lexicon)
OST128235 (lexicon) OST85295 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19662
Vector Insertion
Chr 7: 4655877 - 4656285
Public Clones not available
Private Clones OST384318 (lexicon) OST220533 (lexicon) OST220437 (lexicon) OST56256 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16246
Vector Insertion
Chr 7: 4656318 - 4656669
Public Clones not available
Private Clones OST464552 (lexicon) OST404512 (lexicon) OST54863 (lexicon) OST45004 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26188
Vector Insertion
Chr 7: 4656841 - 4657621
Public Clones not available
Private Clones OST131920 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120836
Sequence
GGGTTAACTGTGGGGAAGGGCCGGGAGTCCCCGGATGGTGATGTCAGCGTGCCGGAGAGAAAGGACGAGGTGGCGGGGGGAGGCGGAGAGGAGGAGGAGG

CGGAGGAGAGAGGGCGC CACGCCCAATATGTGGGCCCCTATCGCCTGGAGAAGACGCTGGGCAAAGGACAGACAG - UNI23004 - GTCTAGTTAA

ACTTGGAGTCCACTGCATCACGGGTCAGAAGGTCGCTGTCAAGATCGTGAACAGGGAGAAGCTGTCGGAATCGGTGCTGATGAAG GTGGAGAGGGAAAT

CGCCATCCTGAAGCTCATTGAACACCCGCACGTGCTCAAGCTCCACGACGTCTACGAGAACAAGAAATATTT - UNI13139 - ATACTTGGTTCTTG

AGCACGTTTCTGGTGGTGAGCTGTTCGACTACCTGGTAAAAAAAGGGAGACTGACACCCAAGGAGGCCCGGAAGTTCTTCCGCCAGATCGTGTCAGCACT

GGACTTCTGCCATAGCTACTCCATCTG - UNI27177 - TCACAGAGACTTGAAGCCAGAGAACCTGCTGTTGGATGAGAAAAACAACATCCGCATCG

CAGACTTTGGTATGGCGTCCCTGCAAGTGGGGGACAGCCTCCTGGAGACCAGCTGCGG GTCCCCCCATTACGCATGTCCAGAGGTGATCAAG GGGGAA

AAGTATGATGGCCGCCGGGCAGACATGTGGAGCTGTGGAGTCATCCTATTTGCCCTGCTTGTG - UNI15694 - GGGGCACTGCCCTTCGATGACGA

CAACCTGCGCCAGCTACTGGAGAAGGTGAAACGTGGGGTCTTCCACATGCCTCACTTCATCCCTCCAGACTGCCAGAGCCTCCTGAGAGGGATGATTGAA

GTGGAGCCCGAGAAAAGGCTCAGT - UNI19662 - CTGGAGCAAATTCAGAAACATCCTTGGTATCT - UNI16246 - GGGCGGGAAACACGAA

CCAGACCCTTGCCTGGAGCCAGCCCCAGGCCGCAGAGTAGCCATGCGTAGCCTGCCTTCCAATGGCGAGCTGGACCCTGACGTTCTGGAAAGCATGGCGT

CTCTGGGCTGCTTCAGAGACCGCGAGCGGCTGCACAGAGAACTGCGAAGCGAGGA - UNI26188 - GGAAAACCAAGAAAAGATGATCTATTATTTG

CTTTTGGATCGGAAAGAGCGGTATCCTAGCTGTGAAGACCAGGACCTGCCTCCTCGGAATGATGTTG ACCCACCTCGTAAGCGTGTGGATTCCCCCATG

CTGAGCAGACACGGGAAACGGAGGCCAGAGCGGAAGTCCATGGAAGTCCTCAGTATCACAGATGCTGGGAGTGGTGGCTCCCCAGTGCCTACCAGACGGG

CCTTGGAGATGGCCCAGCACAGTCAGAG ATCCCGCAGCGTCAGTGGAGCCTCCACTGGTCTGTCCTCCAGCCCTCTGAGCAGCCCAAGG AGTCCGGTC

TTTTCCTTCTCACCGGAGCCAGGCGCTGGAGATGAGGCTAGAGGCGGAGGCTCCCCAACTTCCAAAACACAGACGCTGCCTTCTCGGGGCCCCAGAGGTG

GGGGCGCTGGAGAGCAGCCACCACCCCCCAGTGCCCGTTCCACGCCCTTGCCTGGACCACCAGGCTCCCCGCGCTCCTCCGGCGGAACCCCCTTGCACTC

ACCTCTGCACACGCCTCGAGCCAGCCCTACGGGGACCCCAGGAACGACGCCACCTCCCAGCCCAGGCGGTGGCGTCGGGGGAGCCGCCTGGAGAAGTCGG

CTCAACTCCATCCGCAACAGCTTCCTGGGCTCCCCTCGCTTCCACCGGCGCAAGATGCAGG TCCCTACCGCCGAGGAGATGTCCAGTTTGACACCAGAA

TCCTCTCCTGA GCTGGCAAAACGCTCCTGGTTCGGGAATTTCATCTCCTTGGACAAAGAAGAACAAATATTCCTCGTGCTAAAGGACAAACCTCTCAGC

AGCATCAAAGCGGACATTGTCCATGCCTTTCTGTCG ATCCCCAGCCTGAGTCACAGTGTACTGTCACAGACCAGCTTCAGGGCCGAATACAAGGCCAGC

GGCGGCCCCTCCGTCTTCCAGAAGCCTGTCCGCTTTCAGGTGGACATCAGCTCCTCTGAGGGTCCAGAACCCTCACCCCGAAGAGATGGCAGCAGTGGAG

GTGGCATCTACTCAGTCACCTTTACTCTCATCTCCG GTCCCAGCCGTCGGTTCAAACGTGTGGTAGAGACCATCCAGGCACAGTTGCTGAGTACTCACG

ACCAGCCCTCCGTGCAGGCCTTGGCAG ATGAGAAGAACGGAGCCCAGACCCGGCCTGCTGGGACCCCACCCCGAAGCCTGCAGCCCCCACCAGGCCGCT

CTGACCCTGATCTGAGTAGCTCTCCCCGCCGAGGACCCCCTAAGGACAAGAAGCTCCTGGCCACCAATGGAACCCCTCTACCCTGACCCCAGGGGGCCAG

GGAAGGAGGGGAGCCCCCTCCACCCCCCTTCCCTGCCCCCCTACTGTGAATCTGTATATAAGGCCCAAGGAGTATGTTGGGAGGGGGGACACAAAACTAG

GCCTTGCCCTGCAGGGATAGGGCTCCAGGGGCCATACCCAATGGGGGGGGAGGTTCTAGGGCAAAAAGGGGGTGGGAGCTGTTTTTATTTATTTATTAAT

TAATTTATTATTTTATTTATTGATCAATCTCTGCGGGTGGGGTAGGGGAGGGATGGGGGTGGCTTAGCAGATCCGGACAGGGCCCTCTGTCTCTGTGTCA

TCCCCAACCCCCAGCCCCTTCCTGGCCCCCTGCTCCCCCCCAGGTCCTGCCCCCTCCCCTGTGACCTTCTGTACGGATTTGCCCTCCCGGAAGGAATTCT

GGTTTCGCGTGATCCTGCCTGCGTCTGTGTCTGATTCCGCCGGCGGCAGCAACAACAACAACAACAACAAAAATAAA
Translation
  - UNI23004 - MK VEREIAILKLIEHPHVLKLHDVYENKKYL - UNI13139 - LYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIVSAL

DFCHSYSIC - UNI27177 - CHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCG GSPHYACPEVIK GEKYDGRRADMWSCGVILFALLV

 - UNI15694 - GALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLS - UNI19662 - LEQIQKHPWYL - UNI16246 

- LGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEE - UNI26188 - EENQEKMIYYLLLDRKERYPSCEDQD

LPPRNDVD DPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGSGGSPVPTRRALEMAQHSQR RSRSVSGASTGLSSSPLSSPR SPVFSFSPEPGAGD

EARGGGSPTSKTQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGS

PRFHRRKMQV VPTAEEMSSLTPESSPE ELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS IPSLSHSVLSQTSFRAEYKASGGPSVFQ

KPVRFQVDISSSEGPEPSPRRDGSSGGGIYSVTFTLISG GPSRRFKRVVETIQAQLLSTHDQPSVQALAD DEKNGAQTRPAGTPPRSLQPPPGRSDPD

LSSSPRRGPPKDKKLLATNGTPLP
Transcript ENSMUST00000048248
Sequence
GGGGCCAGCCCAGCCCCCTGGGGACCCCCGGAGAAGTGGGGAGCAACCGGGGGGGCCGGGACGGAGGTGTCGCCGGCCCCCACCGGAGGAACGGGGCGAC

GGGCCGCAGGGGGGGCGGCCGGGGGACCGGTCGGGCCGGGACCAAGGGCACCATGTCGTCCGGGTCCAAGGAAGGTGGCGGGGGCTCCCCCGCCTACCAC

CTCCCACACCCACACCCACACCCACCCCAGCACGCCCAATATGTGGGCCCCTATCGCCTGGAGAAGACGCTGGGCAAAGGACAGACAG - UNI23004 

- GTCTAGTTAAACTTGGAGTCCACTGCATCACGGGTCAGAAGGTCGCTGTCAAGATCGTGAACAGGGAGAAGCTGTCGGAATCGGTGCTGATGAAG GT

GGAGAGGGAAATCGCCATCCTGAAGCTCATTGAACACCCGCACGTGCTCAAGCTCCACGACGTCTACGAGAACAAGAAATATTT - UNI13139 - AT

ACTTGGTTCTTGAGCACGTTTCTGGTGGTGAGCTGTTCGACTACCTGGTAAAAAAAGGGAGACTGACACCCAAGGAGGCCCGGAAGTTCTTCCGCCAGAT

CGTGTCAGCACTGGACTTCTGCCATAGCTACTCCATCTG - UNI27177 - TCACAGAGACTTGAAGCCAGAGAACCTGCTGTTGGATGAGAAAAACA

ACATCCGCATCGCAGACTTTGGTATGGCGTCCCTGCAAGTGGGGGACAGCCTCCTGGAGACCAGCTGCGG GTCCCCCCATTACGCATGTCCAGAGGTGA

TCAAG GGGGAAAAGTATGATGGCCGCCGGGCAGACATGTGGAGCTGTGGAGTCATCCTATTTGCCCTGCTTGTG - UNI15694 - GGGGCACTGCC

CTTCGATGACGACAACCTGCGCCAGCTACTGGAGAAGGTGAAACGTGGGGTCTTCCACATGCCTCACTTCATCCCTCCAGACTGCCAGAGCCTCCTGAGA

GGGATGATTGAAGTGGAGCCCGAGAAAAGGCTCAGT - UNI19662 - CTGGAGCAAATTCAGAAACATCCTTGGTATCT - UNI16246 - GGGC

GGGAAACACGAACCAGACCCTTGCCTGGAGCCAGCCCCAGGCCGCAGAGTAGCCATGCGTAGCCTGCCTTCCAATGGCGAGCTGGACCCTGACGTTCTGG

AAAGCATGGCGTCTCTGGGCTGCTTCAGAGACCGCGAGCGGCTGCACAGAGAACTGCGAAGCGAGGA - UNI26188 - GGAAAACCAAGAAAAGATG

ATCTATTATTTGCTTTTGGATCGGAAAGAGCGGTATCCTAGCTGTGAAGACCAGGACCTGCCTCCTCGGAATGATGTTG ACCCACCTCGTAAGCGTGTG

GATTCCCCCATGCTGAGCAGACACGGGAAACGGAGGCCAGAGCGGAAGTCCATGGAAGTCCTCAGTATCACAGATGCTGGGAGTGGTGGCTCCCCAGTGC

CTACCAGACGGGCCTTGGAGATGGCCCAGCACAGTCAGAG ATCCCGCAGCGTCAGTGGAGCCTCCACTGGTCTGTCCTCCAGCCCTCTGAGCAGCCCAA

GG AGTCCGGTCTTTTCCTTCTCACCGGAGCCAGGCGCTGGAGATGAGGCTAGAGGCGGAGGCTCCCCAACTTCCAAAACACAGACGCTGCCTTCTCGGG

GCCCCAGAGGTGGGGGCGCTGGAGAGCAGCCACCACCCCCCAGTGCCCGTTCCACGCCCTTGCCTGGACCACCAGGCTCCCCGCGCTCCTCCGGCGGAAC

CCCCTTGCACTCACCTCTGCACACGCCTCGAGCCAGCCCTACGGGGACCCCAGGAACGACGCCACCTCCCAGCCCAGGCGGTGGCGTCGGGGGAGCCGCC

TGGAGAAGTCGGCTCAACTCCATCCGCAACAGCTTCCTGGGCTCCCCTCGCTTCCACCGGCGCAAGATGCAGG TCCCTACCGCCGAGGAGATGTCCAGT

TTGACACCAGAATCCTCTCCTGA GCTGGCAAAACGCTCCTGGTTCGGGAATTTCATCTCCTTGGACAAAGAAGAACAAATATTCCTCGTGCTAAAGGAC

AAACCTCTCAGCAGCATCAAAGCGGACATTGTCCATGCCTTTCTGTCG ATCCCCAGCCTGAGTCACAGTGTACTGTCACAGACCAGCTTCAGGGCCGAA

TACAAGGCCAGCGGCGGCCCCTCCGTCTTCCAGAAGCCTGTCCGCTTTCAGGTGGACATCAGCTCCTCTGAGGGTCCAGAACCCTCACCCCGAAGAGATG

GCAGCAGTGGAGGTGGCATCTACTCAGTCACCTTTACTCTCATCTCCG GTCCCAGCCGTCGGTTCAAACGTGTGGTAGAGACCATCCAGGCACAGTTGC

TGAGTACTCACGACCAGCCCTCCGTGCAGGCCTTGGCAG ATGAGAAGAACGGAGCCCAGACCCGGCCTGCTGGGACCCCACCCCGAAGCCTGCAGCCCC

CACCAGGCCGCTCTGACCCTGATCTGAGTAGCTCTCCCCGCCGAGGACCCCCTAAGGACAAGAAGCTCCTGGCCACCAATGGAACCCCTCTACCCTGACC

CCAGGGGGCCAGGGAAGGAGGGGAGCCCCCTCCACCCCCCTTCCCTGCCCCCCTACTGTGAATCTGTATATAAGGCCCAAGGAGTATGTTGGGAGGGGGG

ACACAAAACTAGGCCTTGCCCTGCAGGGATAGGGCTCCAGGGGCCATACCCAATGGGGGGGGAGGTTCTAGGGCAAAAAGGGGGTGGGAGCTGTTTTTAT

TTATTTATTAATTAATTTATTATTTTATTTATTGATCAATCTCTGCGGGTGGGGTAGGGGAGGGATGGGGGTGGCTTAGCAGATCCGGACAGGGCCCTCT

GTCTCTGTGTCATCCCCAACCCCCAGCCCCTTCCTGGCCCCCTGCTCCCCCCCAGGTCCTGCCCCCTCCCCTGTGACCTTCTGTACGGATTTGCCCTCCC

GGAAGGAATTCTGGTTTCGCGTGATCCTGCCTGCGTCTGTGTCTGATTCCGCCGGCGGCAGCAACAACAACAACAACAACAAAAATAAATAGCCTTGATC

AGGG
Translation
MSSGSKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQTG - UNI23004 - GLVKLGVHCITGQKVAVKIVNREKLSESVLMK VEREIAI

LKLIEHPHVLKLHDVYENKKYL - UNI13139 - LYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIVSALDFCHSYSIC - UNI27177 - CH

RDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCG GSPHYACPEVIK GEKYDGRRADMWSCGVILFALLV - UNI15694 - GALPFDDDNLR

QLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLS - UNI19662 - LEQIQKHPWYL - UNI16246 - LGGKHEPDPCLEPAPGRRVAMRS

LPSNGELDPDVLESMASLGCFRDRERLHRELRSEE - UNI26188 - EENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVD DPPRKRVDSPMLSRHG

KRRPERKSMEVLSITDAGSGGSPVPTRRALEMAQHSQR RSRSVSGASTGLSSSPLSSPR SPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGGGA

GEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQV VPTAEEMSSLTPES

SPE ELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS IPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSS

GGGIYSVTFTLISG GPSRRFKRVVETIQAQLLSTHDQPSVQALAD DEKNGAQTRPAGTPPRSLQPPPGRSDPDLSSSPRRGPPKDKKLLATNGTPLP

For any suggestions or comments, please send an email to unitrap@crg.es