Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035392 (Dennd1a)
Chromosomal location
Chr 2: 37654514 - 38142867 (-)
Description
DENN/MADD domain containing 1A Gene [Source:MGI (curated);Acc:Dennd1a-001]
RefSeq_dna
NM_146122 
RefSeq_peptide
NP_666234.2 
UniGene
Mm.314245 
MGI
MGI:2442794 
Uniprot/SWISSPROT
Q8K382 
Uniprot/SPTREMBL
A2ALU3 Q5DTW3 
Human Ortholog
ENSG00000119522 (DENND1A)
Omim not available
UniTrap UNI33805
Vector Insertion
Chr 2: 38015326 - 38098993
Public Clones IST11239A6 (tigm) IST14751F8 (tigm) IST11653D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30622
Vector Insertion
Chr 2: 37904244 - 37982169
Public Clones IST12615A6HMF1 (tigm) IST10821H7 (tigm) IST11012F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7384
Vector Insertion
Chr 2: 37817160 - 37817263
Public Clones RRS431 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36164
Vector Insertion
Chr 2: 37672435 - 37700321
Public Clones IST12353D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040406
Sequence
GCGCTCGCCCGGCTGGAGCGAGTACTTTAACCCCGGGAGGCGACAGCAGCTGCGGCGGCCGGGGAGCGAGCCTCGAGCGGGCGGGCCCCTGCCTGAGGGA

AGGGAGGAAGGGGCGGGGAGAGCTCCTGAGGGAGGCCTGTCGGCCGCGGGCGGGCGGGCAGTGCAGTGCAGCGCAGCACCGAGCGGGGCCCGCGGGTCCA

TGAGGAGGCCCCGGGACCATGGGCTCCAGGATCAA - UNI33805 - GCAAAACCCAGAGACTACATTTGAAGTGTATGTGGAAGTGGCTTATCCTAG

GACAGGTGGCACTCTTTCAG - UNI33805 - ATCCTGAGGTGCAGAGGCAATTCCCAGAGGACTACAGTGACCAG - UNI33805 - GAAGTTCT

ACAGACTTTGACCAAGTTTTGTTTTCCCTTCTATGTGGACAG - UNI30622 - CCTCACAGTTAGCCAAGTTGGCCAGAACTTCACATTTGTGCTCA

CTGACATTGACAGCAAACAGAGATTCGGGTTCTGCCGCTTATCTTCAGGAGCCAAGAGCTGCTTCTGTATCTTAAG - UNI30622 - CTACCTCCCC

TGGTTCGAGGTATTCTATAAGCTCCTTAACATCTTGGCAGATTACACGACGAAACGACAG - UNI30622 - GAAAGTCAGTGGAATGAACTTCTTGA

AACTCTGCACAGACTTCCCATCCCTGATCCTGGAGTGTCTGTTCACCTCAGTGTG CATTCTTACTTCACTGTGCCTGATAGCAGAGAGCTTCCCAGCAT

ACCTGAGAAT AGAAATCTGACAGAATATTTTGTGGCTGTGGATGTGAACAACATGTTGCATCTGTACGCCAGCATGCTGTATGAACGCCGGATCCTCAT

CATCTGCAGCAAGCTCAGTACA TTGACGGCCTGCATCCACGGCTCAGCTGCCATGCTCTACCCTATGTACTGGCAGCATGTGTACATCCCTGTGCTGCC

CCCACATCTGCTGGACTACTGCTG TGCTCCCATGCCCTACCTCATAGGAATCCATTTAAGTTTAATGGAG - UNI7384 - AAGGTCAGGAACATGG

CCCTCGATGATGTTGTGATCTTGAACGTGGACACCAACACCCTGGAAACCCCTTTTGATGACCTCCAGAGCCTCCCAAATGATGTG - UNI7384 - A

TCTCCTCCCTGAAGAACAGGCTGAAGAAGGTCTCTACAACCACAGGTGATGGGGTGGCCAGAGCCTTCCTCAAGGCCCAGGCTGCTTTCTTTGGCAGCTA

CCGGAATGCACTGAAAATTGAGCCA GAAGAACCCATCACTTTCAGTGAGGAAGCCTTTGTATCCCACTACCGCTCTGGAGCCATGAAACAGTTCCTACA

GAATGCCACACAGTTGCAGCTCTTCAAGCAG TTTATCGATGGCCGACTAGACCTTCTCAATTCCGGTGAAGGTTTCAGCGATGTCTTTGAGGAGGAAAT

CAACATGGGAGAGTATGCCG GCAGTGATAAACTGTACCATCAGTGGCTGTCCACAGTCAGG AAAGGAAGTGGTGCGATTCTGAATACTGTAAAAACAA

AAGCTAACCCAGCCATGAAGACTGTCTACAAGTTT GCAAAAGATCATGCAAAAATGGGAATAAAGGAGGTGAAAAACCGCTTGAAGCAAAAG GACATC

ACGGAGAACGGCTGTGTGTCCTCTGCAGAAGATCCACTGCCAAAGACCATGCCATCCCCACAGGCAGAGACCCAGGACCCCAGACTTCGAGAAGACCGGA

GACCAATCACAGTCCACTTTGGGCAG - UNI36164 - GTACGGCCTCCTCGTCCACATGTCGTCAGGAGACCCAAGAGCAACATCACTGTGGAAGGC

AGGAGGACATCTGTCTCAAGCCCTGAGCA - UNI36164 - CCTGGTAAAGCCCTTGCGACACTATGCTGTCTTCCTCTCTGAAGACTCCTCTGATGA

GGAATGCCGACGGGAAGAGGCCCCCAGCACTGGCTTCACTGAAAGCCTTCTCTTCTCTGCTCCCTTTGAATG GCCACAGCCATACCGGACATTGAAAGA

ATCAGACAGCGCAGAAGGTGATGAGACCGAGAGTCCAGAGCAGCTAGTTCGAGAACCCTGGGGACCTACCCCTGCTCCACCTGACCGAGCTGCCAGCATT

GACCTTCTAGAAGATGTCTTCAGCAGCCTAGACGTGGAGGCACCACTGCAGCCGCTGGGCCAAGCCAAGAGCCTGGAGGATCTCCGGGCCCCCAAAGACT

TGCGGGAACAGCCAGGGAGCTTTGATTACCAG AGACTGGACCTGTGCAGAAGTGAGAGGGGCCTTAGCATGGCTGCAGCCTTGAAGCTTGCTCATCCAT

ATACTAAGCTCTGGAGTCTGGGTCAGGACGACATGGCCATCCCCAGCAAGCCCTCCATAACCTCCCCTGAGAAGCCCTCAGCTCTGCTTGGTACTTCCCC

AGCCCTGCCTCTCAGACCCCAGAACCAGGAGGGCATCCTGAGCCCCAGCATCAAGGAGGAGACTCCCATCCCAACTCCGGGCAGCATCACCATTCCCAGG

CCACAAGGCAGAAAGACCCCTGAGCTGGGCATCGTGCCTCCACCACCCACTGCCCGGCCAGCCAAGCTCCAGGCTGCTGGCGGCCCACTTGGTGACTTCT

CTTCAGAGCCACTGCAGATGGACCGGGAAAGACAAGCCGCTCTGAGTCCAGCCCTCCTGTCAGGGCTGCTCCCCAGAGCTGTCCCCCAAGGTCCCACAGA

ACTTCTGCAGCCACCCAGCCCAGCCCCAGGAGCTGCAGGCACAGGCAGCGATGCCCTGCTCGCTCTCCTGGATCCACTTAACACAGCCTGGTCAGGCAGC

ACCATCCCATCACATCCTGCTACCCCCAGTGCAGCCACCCCATTCATCCCTCAGCTCAGCTTCCCCCCAACAGTGACACCCACCCCTTTTGTACAGACAC

CACTCAATCCCTTTGTCCCATCTGTGCCAGTAGTACCACCCTCCATGCCCCTGAGCTCTACACCAGCCAGGCCTTTTGGGACCCCTCCAGCATCCCTAGG

GCCAGCATATGCACCTAGCATTCTATTGTCTAGTTCTGGCTTCTATGCCCCTCACAGGTCTCAGCCCAACCTCTCTGCTCTCTCCATGCCCAACCTCTTT

GGCCAGATCCCAATGGGTGCCCACACTAGTCCCCTGCAGCCACTTGGCCCCCCAGCCGTTGCCCCCTCCAGGATCCGAACATTGCCTCTGGCCCGCTCAA

GTGCCAGGGCTGCTGAGGCCAAGCAGGGGTTGGCCCTGAGGCCTGGTGAATCCCCACTGTTGCCTCCCAGACCGCCCCAGAGCCTACAGCCAACCCCGCA

GCCCTCTGTTCCTACACAGGCCAGAGACCCCTTTGAGGATTTGCTGCGAAAAACCAAGCAAGATGTGAGCCCAAGCCCAGCCCCGGCCCTGGCCCCAGCC

TCCACCTCCGTGGAGCAGCTCCGCAGACAGTGGGAGACCTTTGAGTGAGCAGGCCTGTGCCACTGTCTAATACTGTGCCTCCCCAACGTCCCATTTCTAG

CCAGGCTTCATGGGGCAAAGGGACTCTGCCCCCTCCTCCACAGCCCATCTCTGAGGCCTGGCCCTGGGAATGGCCATCCCAGAAGAGCTGCCTGCCGCCA

CCCTTGGCACCCTGTGTGGGTTTTGCACTATATGTCAACTGGACCAGCTGTATCCTATCCTCCCATAGCCCAAGAGGAGTCAAGAAGCTCAAGGCTGCTT

TCAAGCCCAGCTCTCCTCCTTTGCTGGGCCCCACCCCACAGGGCAGATGTCAGTAACAACCTGTGTAAGCACAGCTTTGGGGGACATGGGTGTTTGGGGG

GCTGAAATGAGGCCCACTCCTAGGCTGGCATTTCTCCCTGGTGGTCATCTCCAAACCTCTCTAGCAATATACTCTTTCCTGAGTCTTCACCTAACCACCA

ACTGGAGTTGTTCCTGAAGGGTCAGGGGTCTGGAGACCTAATGGTCAGCAAACCCAGCCCCAGCCAGCTCTTCCAGGGGTTGGGAACACCAGCAACTCTA

ACTTATAAGAGAAGCTCCAAACCTGAGTCTTAGGAGCCGCCCTCAGCTCTCTGCCACCCTCATACCTCTGGGCTCTCGTGTCAGTCAAAGCTCAGGCCCA

GCCTCCTGCCACTTGGAGCTTTATGGGCAGAGCTGGGCAGCAGTGACCCAGATTCCAACTCAAAGGACAAGCTTCCTGCCACAGACAAAGGGAGGGAGGC

ACAGCTGTTAGAGCTCCTGGGTCAGGACCAGGTGGGGCCCCAGGGCTCCCCAGGTTCCCCCATGGAGTGAAGATACACGTGGCCTCTGAGCGTGCGGCAA

GTGGGGGCCTGGAAGCCAGCCCTCCCCACTCTCTCCAGCTTCTCGACAGCGCAGAAATTCCTGAGCCCAAGTCACCAAAGTTATAATGAAATGTTTTGTT

ATTTTTTCTTTGATCTTGCTTTTCCTTTTTACCTTATTGATTTGATGAATCTTGAAAATTGATTCCTTTCAATAAACCAAGGTAAAACAC
Translation
 - UNI33805 -  - UNI33805 -  - UNI33805 -  - UNI30622 -  - UNI30622 -  - UNI30622 -      - UNI7384 -

  - UNI7384 -     MKTVYKF AKDHAKMGIKEVKNRLKQK DITENGCVSSAEDPLPKTMPSPQAETQDPRLREDRRPITVHFGQ - UNI3616

4 - VRPPRPHVVRRPKSNITVEGRRTSVSSPEH - UNI36164 - HLVKPLRHYAVFLSEDSSDEECRREEAPSTGFTESLLFSAPFEW WPQPYRT

LKESDSAEGDETESPEQLVREPWGPTPAPPDRAASIDLLEDVFSSLDVEAPLQPLGQAKSLEDLRAPKDLREQPGSFDYQ RLDLCRSERGLSMAAALKL

AHPYTKLWSLGQDDMAIPSKPSITSPEKPSALLGTSPALPL
Transcript ENSMUST00000090997
Sequence
GCGCTCGCCCGGCTGGAGCGAGTACTTTAACCCCGGGAGGCGACAGCAGCTGCGGCGGCCGGGGAGCGAGCCTCGAGCGGGCGGGCCCCTGCCTGAGGGA

AGGGAGGAAGGGGCGGGGAGAGCTCCTGAGGGAGGCCTGTCGGCCGCGGGCGGGCGGGCAGTGCAGTGCAGCGCAGCACCGAGCGGGGCCCGCGGGTCCA

TGAGGAGGCCCCGGGACCATGGGCTCCAGGATCAA - UNI33805 - GCAAAACCCAGAGACTACATTTGAAGTGTATGTGGAAGTGGCTTATCCTAG

GACAGGTGGCACTCTTTCAG - UNI33805 - ATCCTGAGGTGCAGAGGCAATTCCCAGAGGACTACAGTGACCAG - UNI33805 - GAAGTTCT

ACAGACTTTGACCAAGTTTTGTTTTCCCTTCTATGTGGACAG - UNI30622 - CCTCACAGTTAGCCAAGTTGGCCAGAACTTCACATTTGTGCTCA

CTGACATTGACAGCAAACAGAGATTCGGGTTCTGCCGCTTATCTTCAGGAGCCAAGAGCTGCTTCTGTATCTTAAG - UNI30622 - CTACCTCCCC

TGGTTCGAGGTATTCTATAAGCTCCTTAACATCTTGGCAGATTACACGACGAAACGACAG - UNI30622 - GAAAGTCAGTGGAATGAACTTCTTGA

AACTCTGCACAGACTTCCCATCCCTGATCCTGGAGTGTCTGTTCACCTCAGTGTG CATTCTTACTTCACTGTGCCTGATAGCAGAGAGCTTCCCAGCAT

ACCTGAGAAT AGAAATCTGACAGAATATTTTGTGGCTGTGGATGTGAACAACATGTTGCATCTGTACGCCAGCATGCTGTATGAACGCCGGATCCTCAT

CATCTGCAGCAAGCTCAGTACA TTGACGGCCTGCATCCACGGCTCAGCTGCCATGCTCTACCCTATGTACTGGCAGCATGTGTACATCCCTGTGCTGCC

CCCACATCTGCTGGACTACTGCTG TGCTCCCATGCCCTACCTCATAGGAATCCATTTAAGTTTAATGGAG - UNI7384 - AAGGTCAGGAACATGG

CCCTCGATGATGTTGTGATCTTGAACGTGGACACCAACACCCTGGAAACCCCTTTTGATGACCTCCAGAGCCTCCCAAATGATGTG - UNI7384 - A

TCTCCTCCCTGAAGAACAGGCTGAAGAAGGTCTCTACAACCACAGGTGATGGGGTGGCCAGAGCCTTCCTCAAGGCCCAGGCTGCTTTCTTTGGCAGCTA

CCGGAATGCACTGAAAATTGAGCCA CCAC GCAGAGACCCAGGACCCCAGACTTCGAGAAGACCG - UNI36164 - CCAATCACAGTCCACTTTGG

GCAG - UNI36164 - GTACGGCCTCCTCGTCCACATGTCGTCAGGAGACCCAAGAGCAACATCACTGTGGAAGGCAGGAGGACATCTGTCTCAAGCC

CTGAGCA - UNI36164 - GCCACAGCCATACCGGACATTGAAAGAATCAGACAGCGCAGAAGGTGATGAGACCGAGAGTCCAGAGCAGCTAGTTCGA

GAACCCTGGGGACCTACCCCTGCTCCACCTGACCGAGCTGCCAGCATTGACCTTCTAGAAGATGTCTTCAGCAGCCTAGACGTGGAGGCACCACTGCAGC

CGCTGGGCCAAGCCAAGAGCCTGGAGGATCTCCGGGCCCCCAAAGACTTGCGGGAACAGCCAGGGAGCTTTGATTACCAG AGACTGGACCTGTGCAGAA

GTGAGAGGGGCCTTAGCATGGCTGCAGCCTTGAAGCTTGCTCATCCATATACTAAGCTCTGGAGTCTGGGTCAGGACGACATGGCCATCCCCAGCAAGCC

CTCCATAACCTCCCCTGAGAAGCCCTCAGCTCTGCTTGGTACTTCCCCAGCCCTGCCTCTCAGACCCCAGAACCAGGAGGGCATCCTGAGCCCCAGCATC

AAGGAGGAGACTCCCATCCCAACTCCGGGCAGCATCACCATTCCCAGGCCACAAGGCAGAAAGACCCCTGAGCTGGGCATCGTGCCTCCACCACCCACTG

CCCGGCCAGCCAAGCTCCAGGCTGCTGGCGGCCCACTTGGTGACTTCTCTTCAGAGCCACTGCAGATGGACCGGGAAAGACAAGCCGCTCTGAGTCCAGC

CCTCCTGTCAGGGCTGCTCCCCAGAGCTGTCCCCCAAGGTCCCACAGAACTTCTGCAGCCACCCAGCCCAGCCCCAGGAGCTGCAGGCACAGGCAGCGAT

GCCCTGCTCGCTCTCCTGGATCCACTTAACACAGCCTGGTCAGGCAGCACCATCCCATCACATCCTGCTACCCCCAGTGCAGCCACCCCATTCATCCCTC

AGCTCAGCTTCCCCCCAACAGTGACACCCACCCCTTTTGTACAGACACCACTCAATCCCTTTGTCCCATCTGTGCCAGTAGTACCACCCTCCATGCCCCT

GAGCTCTACACCAGCCAGGCCTTTTGGGACCCCTCCAGCATCCCTAGGGCCAGCATATGCACCTAGCATTCTATTGTCTAGTTCTGGCTTCTATGCCCCT

CACAGGTCTCAGCCCAACCTCTCTGCTCTCTCCATGCCCAACCTCTTTGGCCAGATCCCAATGGGTGCCCACACTAGTCCCCTGCAGCCACTTGGCCCCC

CAGCCGTTGCCCCCTCCAGGATCCGAACATTGCCTCTGGCCCGCTCAAGTGCCAGGGCTGCTGAGGCCAAGCAGGGGTTGGCCCTGAGGCCTGGTGAATC

CCCACTGTTGCCTCCCAGACCGCCCCAGAGCCTACAGCCAACCCCGCAGCCCTCTGTTCCTACACAGGCCAGAGACCCCTTTGAGGATTTGCTGCGAAAA

ACCAAGCAAGATGTGAGCCCAAGCCCAGCCCCGGCCCTGGCCCCAGCCTCCACCTCCGTGGAGCAGCTCCGCAGACAGTGGGAGACCTTTGAGTGAGCAG

GCCTGTGCCACTGTCTAATACTGTGCCTCCCCAACGTCCCATTTCTAGCCAGGCTTCATGGGGCAAAGGGACTCTGCCCCCTCCTCCACAGCCCATCTCT

GAGGCCTGGCCCTGGGAATGGCCATCCCAGAAGAGCTGCCTGCCGCCACCCTTGGCACCCTGTGTGGGTTTTGCACTATATGTCAACTGGACCAGCTGTA

TCCTATCCTCCCATAGCCCAAGAGGAGTCAAGAAGCTCAAGGCTGCTTTCAAGCCCAGCTCTCCTCCTTTGCTGGGCCCCACCCCACAGGGCAGATGTCA

GTAACAACCTGTGTAAGCACAGCTTTGGGGGACATGGGTGTTTGGGGGGCTGAAATGAGGCCCACTCCTAGGCTGGCATTTCTCCCTGGTGGTCATCTCC

AAACCTCTCTAGCAATATACTCTTTCCTGAGTCTTCACCTAACCACCAACTGGAGTTGTTCCTGAAGGGTCAGGGGTCTGGAGACCTAATGGTCAGCAAA

CCCAGCCCCAGCCAGCTCTTCCAGGGGTTGGGAACACCAGCAACTCTAACTTATAAGAGAAGCTCCAAACCTGAGTCTTAGGAGCCGCCCTCAGCTCTCT

GCCACCCTCATACCTCTGGGCTCTCGTGTCAGTCAAAGCTCAGGCCCAGCCTCCTGCCACTTGGAGCTTTATGGGCAGAGCTGGGCAGCAGTGACCCAGA

TTCCAACTCAAAGGACAAGCTTCCTGCCACAGACAAAGGGAGGGAGGCACAGCTGTTAGAGCTCCTGGGTCAGGACCAGGTGGGGCCCCAGGGCTCCCCA

GGTTCCCCCATGGAGTGAAGATACACGTGGCCTCTGAGCGTGCGGCAAGTGGGGGCCTGGAAGCCAGCCCTCCCCACTCTCTCCAGCTTCTCGACAGCGC

AGAAATTCCTGAGCCCAAGTCACCAAAGTTATAATGAAATGTTTTGTTATTTTTTCTTTGATCTTGCTTTTCCTTTTTACCTTATTGATTTGATGAATCT

TGAAAATTGATTCCTTTCAATAAACCAAGGTAAAACAC
Translation
MGSRIK - UNI33805 - KQNPETTFEVYVEVAYPRTGGTLSD - UNI33805 - DPEVQRQFPEDYSDQ - UNI33805 - EVLQTLTKFCFP

FYVDS - UNI30622 - SLTVSQVGQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILS - UNI30622 - SYLPWFEVFYKLLNILADYTTKRQ -

 UNI30622 - ESQWNELLETLHRLPIPDPGVSVHLSV HSYFTVPDSRELPSIPEN RNLTEYFVAVDVNNMLHLYASMLYERRILIICSKLST LTA

CIHGSAAMLYPMYWQHVYIPVLPPHLLDYCC CAPMPYLIGIHLSLME - UNI7384 - KVRNMALDDVVILNVDTNTLETPFDDLQSLPNDV - UN

I7384 - ISSLKNRLKKVSTTTGDGVARAFLKAQAAFFGSYRNALKIEP PR RRDPGPQTSRRP - UNI36164 - PITVHFGQ - UNI36164 

- VRPPRPHVVRRPKSNITVEGRRTSVSSPEQ - UNI36164 - QPQPYRTLKESDSAEGDETESPEQLVREPWGPTPAPPDRAASIDLLEDVFSSLD

VEAPLQPLGQAKSLEDLRAPKDLREQPGSFDYQ RLDLCRSERGLSMAAALKLAHPYTKLWSLGQDDMAIPSKPSITSPEKPSALLGTSPALPLRPQNQE

GILSPSIKEETPIPTPGSITIPRPQGRKTPELGIVPPPPTARPAKLQAAGGPLGDFSSEPLQMDRERQAALSPALLSGLLPRAVPQGPTELLQPPSPAPG

AAGTGSDALLALLDPLNTAWSGSTIPSHPATPSAATPFIPQLSFPPTVTPTPFVQTPLNPFVPSVPVVPPSMPLSSTPARPFGTPPASLGPAYAPSILLS

SSGFYAPHRSQPNLSALSMPNLFGQIPMGAHTSPLQPLGPPAVAPSRIRTLPLARSSARAAEAKQGLALRPGESPLLPPRPPQSLQPTPQPSVPTQARDP

FEDLLRKTKQDVSPSPAPALAPASTSVEQLRRQWETFE
Transcript ENSMUST00000102787
Sequence
GCGCTCGCCCGGCTGGAGCGAGTACTTTAACCCCGGGAGGCGACAGCAGCTGCGGCGGCCGGGGAGCGAGCCTCGAGCGGGCGGGCCCCTGCCTGAGGGA

AGGGAGGAAGGGGCGGGGAGAGCTCCTGAGGGAGGCCTGTCGGCCGCGGGCGGGCGGGCAGTGCAGTGCAGCGCAGCACCGAGCGGGGCCCGCGGGTCCA

TGAGGAGGCCCCGGGACCATGGGCTCCAGGATCAA - UNI33805 - GCAAAACCCAGAGACTACATTTGAAGTGTATGTGGAAGTGGCTTATCCTAG

GACAGGTGGCACTCTTTCAG - UNI33805 - ATCCTGAGGTGCAGAGGCAATTCCCAGAGGACTACAGTGACCAG - UNI33805 - GAAGTTCT

ACAGACTTTGACCAAGTTTTGTTTTCCCTTCTATGTGGACAG - UNI30622 - CCTCACAGTTAGCCAAGTTGGCCAGAACTTCACATTTGTGCTCA

CTGACATTGACAGCAAACAGAGATTCGGGTTCTGCCGCTTATCTTCAGGAGCCAAGAGCTGCTTCTGTATCTTAAG - UNI30622 - CTACCTCCCC

TGGTTCGAGGTATTCTATAAGCTCCTTAACATCTTGGCAGATTACACGACGAAACGACAG - UNI30622 - GAAAGTCAGTGGAATGAACTTCTTGA

AACTCTGCACAGACTTCCCATCCCTGATCCTGGAGTGTCTGTTCACCTCAGTGTG CATTCTTACTTCACTGTGCCTGATAGCAGAGAGCTTCCCAGCAT

ACCTGAGAAT AGAAATCTGACAGAATATTTTGTGGCTGTGGATGTGAACAACATGTTGCATCTGTACGCCAGCATGCTGTATGAACGCCGGATCCTCAT

CATCTGCAGCAAGCTCAGTACA TTGACGGCCTGCATCCACGGCTCAGCTGCCATGCTCTACCCTATGTACTGGCAGCATGTGTACATCCCTGTGCTGCC

CCCACATCTGCTGGACTACTGCTG TGCTCCCATGCCCTACCTCATAGGAATCCATTTAAGTTTAATGGAG - UNI7384 - AAGGTCAGGAACATGG

CCCTCGATGATGTTGTGATCTTGAACGTGGACACCAACACCCTGGAAACCCCTTTTGATGACCTCCAGAGCCTCCCAAATGATGTG - UNI7384 - A

TCTCCTCCCTGAAGAACAGGCTGAAGAAGGTCTCTACAACCACAGGTGATGGGGTGGCCAGAGCCTTCCTCAAGGCCCAGGCTGCTTTCTTTGGCAGCTA

CCGGAATGCACTGAAAATTGAGCCA GAAGAACCCATCACTTTCAGTGAGGAAGCCTTTGTATCCCACTACCGCTCTGGAGCCATGAAACAGTTCCTACA

GAATGCCACACAGTTGCAGCTCTTCAAGCAG TTTATCGATGGCCGACTAGACCTTCTCAATTCCGGTGAAGGTTTCAGCGATGTCTTTGAGGAGGAAAT

CAACATGGGAGAGTATGCCG GCAGTGATAAACTGTACCATCAGTGGCTGTCCACAGTCAGG AAAGGAAGTGGTGCGATTCTGAATACTGTAAAAACAA

AAGCTAACCCAGCCATGAAGACTGTCTACAAGTTT GCAAAAGATCATGCAAAAATGGGAATAAAGGAGGTGAAAAACCGCTTGAAGCAAAAG GACATC

ACGGAGAACGGCTGTGTGTCCTCTGCAGAAGATCCACTGCCAAAGACCATGCCATCCCCACAGGCAGAGACCCAGGACCCCAGACTTCGAGAAGACCGGA

GACCAATCACAGTCCACTTTGGGCAG - UNI36164 - GTACGGCCTCCTCGTCCACATGTCGTCAGGAGACCCAAGAGCAACATCACTGTGGAAGGC

AGGAGGACATCTGTCTCAAGCCCTGAGCA - UNI36164 - GCCACAGCCATACCGGACATTGAAAGAATCAGACAGCGCAGAAGGTGATGAGACCGA

GAGTCCAGAGCAGCTAGTTCGAGAACCCTGGGGACCTACCCCTGCTCCACCTGACCGAGCTGCCAGCATTGACCTTCTAGAAGATGTCTTCAGCAGCCTA

GACGTGGAGGCACCACTGCAGCCGCTGGGCCAAGCCAAGAGCCTGGAGGATCTCCGGGCCCCCAAAGACTTGCGGGAACAGCCAGGGAGCTTTGATTACC

AG AGACTGGACCTGTGCAGAAGTGAGAGGGGCCTTAGCATGGCTGCAGCCTTGAAGCTTGCTCATCCATATACTAAGCTCTGGAGTCTGGGTCAGGACG

ACATGGCCATCCCCAGCAAGCCCTCCATAACCTCCCCTGAGAAGCCCTCAGCTCTGCTTGGTACTTCCCCAGCCCTGCCTCTCAGACCCCAGAACCAGGA

GGGCATCCTGAGCCCCAGCATCAAGGAGGAGACTCCCATCCCAACTCCGGGCAGCATCACCATTCCCAGGCCACAAGGCAGAAAGACCCCTGAGCTGGGC

ATCGTGCCTCCACCACCCACTGCCCGGCCAGCCAAGCTCCAGGCTGCTGGCGGCCCACTTGGTGACTTCTCTTCAGAGCCACTGCAGATGGACCGGGAAA

GACAAGCCGCTCTGAGTCCAGCCCTCCTGTCAGGGCTGCTCCCCAGAGCTGTCCCCCAAGGTCCCACAGAACTTCTGCAGCCACCCAGCCCAGCCCCAGG

AGCTGCAGGCACAGGCAGCGATGCCCTGCTCGCTCTCCTGGATCCACTTAACACAGCCTGGTCAGGCAGCACCATCCCATCACATCCTGCTACCCCCAGT

GCAGCCACCCCATTCATCCCTCAGCTCAGCTTCCCCCCAACAGTGACACCCACCCCTTTTGTACAGACACCACTCAATCCCTTTGTCCCATCTGTGCCAG

TAGTACCACCCTCCATGCCCCTGAGCTCTACACCAGCCAGGCCTTTTGGGACCCCTCCAGCATCCCTAGGGCCAGCATATGCACCTAGCATTCTATTGTC

TAGTTCTGGCTTCTATGCCCCTCACAGGTCTCAGCCCAACCTCTCTGCTCTCTCCATGCCCAACCTCTTTGGCCAGATCCCAATGGGTGCCCACACTAGT

CCCCTGCAGCCACTTGGCCCCCCAGCCGTTGCCCCCTCCAGGATCCGAACATTGCCTCTGGCCCGCTCAAGTGCCAGGGCTGCTGAGGCCAAGCAGGGGT

TGGCCCTGAGGCCTGGTGAATCCCCACTGTTGCCTCCCAGACCGCCCCAGAGCCTACAGCCAACCCCGCAGCCCTCTGTTCCTACACAGGCCAGAGACCC

CTTTGAGGATTTGCTGCGAAAAACCAAGCAAGATGTGAGCCCAAGCCCAGCCCCGGCCCTGGCCCCAGCCTCCACCTCCGTGGAGCAGCTCCGCAGACAG

TGGGAGACCTTTGAGTGAGCAGGCCTGTGCCACTGTCTAATACTGTGCCTCCCCAACGTCCCATTTCTAGCCAGGCTTCATGGGGCAAAGGGACTCTGCC

CCCTCCTCCACAGCCCATCTCTGAGGCCTGGCCCTGGGAATGGCCATCCCAGAAGAGCTGCCTGCCGCCACCCTTGGCACCCTGTGTGGGTTTTGCACTA

TATGTCAACTGGACCAGCTGTATCCTATCCTCCCATAGCCCAAGAGGAGTCAAGAAGCTCAAGGCTGCTTTCAAGCCCAGCTCTCCTCCTTTGCTGGGCC

CCACCCCACAGGGCAGATGTCAGTAACAACCTGTGTAAGCACAGCTTTGGGGGACATGGGTGTTTGGGGGGCTGAAATGAGGCCCACTCCTAGGCTGGCA

TTTCTCCCTGGTGGTCATCTCCAAACCTCTCTAGCAATATACTCTTTCCTGAGTCTTCACCTAACCACCAACTGGAGTTGTTCCTGAAGGGTCAGGGGTC

TGGAGACCTAATGGTCAGCAAACCCAGCCCCAGCCAGCTCTTCCAGGGGTTGGGAACACCAGCAACTCTAACTTATAAGAGAAGCTCCAAACCTGAGTCT

TAGGAGCCGCCCTCAGCTCTCTGCCACCCTCATACCTCTGGGCTCTCGTGTCAGTCAAAGCTCAGGCCCAGCCTCCTGCCACTTGGAGCTTTATGGGCAG

AGCTGGGCAGCAGTGACCCAGATTCCAACTCAAAGGACAAGCTTCCTGCCACAGACAAAGGGAGGGAGGCACAGCTGTTAGAGCTCCTGGGTCAGGACCA

GGTGGGGCCCCAGGGCTCCCCAGGTTCCCCCATGGAGTGAAGATACACGTGGCCTCTGAGCGTGCGGCAAGTGGGGGCCTGGAAGCCAGCCCTCCCCACT

CTCTCCAGCTTCTCGACAGCGCAGAAATTCCTGAGCCCAAGTCACCAAAGTTATAATGAAATGTTTTGTTATTTTTTCTTTGATCTTGCTTTTCCTTTTT

ACCTTATTGATTTGATGAATCTTGAAAATTGATTCCTTTCAATAAACCAAGGTAAAACAC
Translation
MGSRIK - UNI33805 - KQNPETTFEVYVEVAYPRTGGTLSD - UNI33805 - DPEVQRQFPEDYSDQ - UNI33805 - EVLQTLTKFCFP

FYVDS - UNI30622 - SLTVSQVGQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILS - UNI30622 - SYLPWFEVFYKLLNILADYTTKRQ -

 UNI30622 - ESQWNELLETLHRLPIPDPGVSVHLSV HSYFTVPDSRELPSIPEN RNLTEYFVAVDVNNMLHLYASMLYERRILIICSKLST LTA

CIHGSAAMLYPMYWQHVYIPVLPPHLLDYCC CAPMPYLIGIHLSLME - UNI7384 - KVRNMALDDVVILNVDTNTLETPFDDLQSLPNDV - UN

I7384 - ISSLKNRLKKVSTTTGDGVARAFLKAQAAFFGSYRNALKIEP EEPITFSEEAFVSHYRSGAMKQFLQNATQLQLFKQ FIDGRLDLLNSGE

GFSDVFEEEINMGEYAG GSDKLYHQWLSTVR KGSGAILNTVKTKANPAMKTVYKF AKDHAKMGIKEVKNRLKQK DITENGCVSSAEDPLPKTMPSP

QAETQDPRLREDRRPITVHFGQ - UNI36164 - VRPPRPHVVRRPKSNITVEGRRTSVSSPEQ - UNI36164 - QPQPYRTLKESDSAEGDETE

SPEQLVREPWGPTPAPPDRAASIDLLEDVFSSLDVEAPLQPLGQAKSLEDLRAPKDLREQPGSFDYQ RLDLCRSERGLSMAAALKLAHPYTKLWSLGQD

DMAIPSKPSITSPEKPSALLGTSPALPLRPQNQEGILSPSIKEETPIPTPGSITIPRPQGRKTPELGIVPPPPTARPAKLQAAGGPLGDFSSEPLQMDRE

RQAALSPALLSGLLPRAVPQGPTELLQPPSPAPGAAGTGSDALLALLDPLNTAWSGSTIPSHPATPSAATPFIPQLSFPPTVTPTPFVQTPLNPFVPSVP

VVPPSMPLSSTPARPFGTPPASLGPAYAPSILLSSSGFYAPHRSQPNLSALSMPNLFGQIPMGAHTSPLQPLGPPAVAPSRIRTLPLARSSARAAEAKQG

LALRPGESPLLPPRPPQSLQPTPQPSVPTQARDPFEDLLRKTKQDVSPSPAPALAPASTSVEQLRRQWETFE

For any suggestions or comments, please send an email to unitrap@crg.es