Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035401 (2210018M11Rik)
Chromosomal location
Chr 7: 105739125 - 105805079 (-)
Description
RIKEN cDNA 2210018M11 gene Gene [Source:MGI Symbol;Acc:MGI:1924203]
RefSeq_dna
NM_172280 
RefSeq_peptide
NP_758484.2 
MGI
MGI:1924203 
Uniprot/SWISSPROT
Q8BMB0 
Human Ortholog
ENSG00000158636 (C11orf30)
Omim not available
UniTrap UNI23152
Vector Insertion
Chr 7: 105803363 - 105804983
Public Clones PST17314-NR (escells)
Private Clones OST274740 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6041
Vector Insertion
Chr 7: 105770051 - 105774975
Public Clones YHD044 (baygenomics) BGC020 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8666
Vector Insertion
Chr 7: 105761668 - 105763985
Public Clones RRK255 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9307
Vector Insertion
Chr 7: 105759376 - 105761493
Public Clones XH265 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098271
Sequence
CTTGCCCCTTCTGAGGCACCGCAAACAAACCTAATTCCTGGTGTCCCCTAGTCTTGGCGGAGGAGCCTTTTAGATGAGCCCCGAAAGGCCGGGCAG - U

NI23152 - GGAGGACAAGCTCTTTGGGGCTACCAGACAGAAGCAGCAATGCCTGTTGTGTGGCCAACCCTTTTGGATCTCAGCAGGGATGAATGCAAA

CGGATTCTTCGAAAATTGG AACTGGAGGCATATGCTGGAGTTATCAGTGCACTTCGGGCACAAGGGGACCTCACCAAGGAAAAGAAAGATCTTCTTGGA

GAGCTCTCAAAAGTCCTTAG CATCTCAACAGAGCGCCACCGTGCTGAAGTTCGGAGAGCAGTAAACGATGAACGGTTAACAACAATTGCACATAA AAT

GAATTTATCCTTATATTTGGGTGAAAGACCAAGTTACAG TATGTCTGGACCTAATAGTTCTTCAGAGTGGTCCATCGAAGGACGTAGATTGGTACCTCT

GATGCCCAGGCTGGTTCCCCAGACTGCCTTCACTGTAACAGCGAATGCTGTGGCCAATGCAGCTGTCCAGCACAATGCGTCCCTTCCTGTGCCTGCAGAG

ACAGCAAGCAAAGACG GCGTTAGCTGCTCAGATGAAGATGAAAAACCCAGAAAACGCAGGCGAACAAACTCCTCTAGCTCCTCCCCTGTTGTCCTCAAG

GAAGTTCCAAAGGCTGTTGTTCCGGTCTCAAAGACGATCACTGTGCCTGTGAGTGGAAGTCCCAAGATGAGCAACATTATGCAGAGCATTGCCAACTCCT

TACCACCCCATATGTCACCTGTGAAAATAACGTTTACCAAACCATCAACACAGACAACAAACACAACAACACAGAAG GTTATTATAGTGACCACATCAC

CAAGTTCAACCTTTGTGCCCAACATTCTCTCCAAATCTCATAACTATGCAGCAGTCACTAAGCTTGTACCAACATCAGTCATTGCCTCCACGACTCAGAA

GCCACCTGTTGTTATAACTGCGTCCCAGGCCTCTCTGGTCACCAGTAGCAGCAATGGCAACAGCAGTTCTACGTCATCACCTATTTCTAGTACAGTTGCA

GTAACAACGGTGGTATCTTCCACACCGTCCGTGGTCATGTCAACAGTAGCACAAG GTGTATCCACATCAGCAATCAAAGTGGCATCGACAAGACTTCCT

TCCCCCAAAAGCTTAGTGAGTGGCCCTACCCAGATTCTTGCACAGTTTCCTAAACAGCATCAGCAGTCTCCTAAGCAGCAGTTACAGCAAGTACAACAAC

AGACACAGCAGCCAGTGGCCCAGCCTTCTTCAGTGTCTCAGCAGCAGCAGCCTCAGCAGTCAGCATTGCCGCCTGGTATCAAACCTACCATCCAGATCAA

ACAGGAGTCAG - UNI6041 - GTGTTAAAATCATCACACAGCAGGTTCAACCAAGTAAAATCTTACCCAAACCAGTGACTGCAACTCTACCCACCAG

TAGCAATTCCCCAATTATGGTGGTTAGCAGTAATGGTGCAATTATGACAACTAAACTGGTAACCACTCCTACCG GTACTCAGGCAACCTATACCCGGCC

AACAGTGAGCCCATCCTTAGGTCGTGTGGCTACAACCCCTGGAGCTGCAACCTATGTGAAAACTACCAGTGGCAGCATCATCACTGTAGTACCCAAATCA

TTAGCTACCTTGGGAGGCAAGATAATTAGCAGTAATATTGTTTCTG GAACGACTACCAAAATCACTACAATCCCAATGACTTCCAAGCCCAATGTGATT

GTTGTACAAAAGACTACAGGAAAAGGAACGACCATTCAAGGCCTCCCTGGCAAAAACGTTGTCACAACCTTGCTAAATGCTGGA - UNI8666 - GGA

GAAAAGACTCTTCAGACAGTGCCAGCTGGAGCCAAGCCAGCTATAATTACTGCTACAAGACCCATCACCAAAATGATTGTAACACAGCCCAAAGGAATAG

GTTCCGCAGTACAGCCAGCAGCTAAAATCATTCCAACAAAAATTGTGTATGGACAACAAGGGAAAACACAG - UNI9307 - GTTCTAATTAAACCCA

AACCAGTGACATTTCAAGCTACAGTTGTCAGTGAACAAACAAGGCAGCTGGTAACAGAAACATTACAGCAAGCATCCAGGGTAGCAGATGCCAGTAATTC

ATCTGCTCAGGAAGGAAAAGAGGAGCCACAGGGTTACACAGACAGTAGTTCTTCTTCCACAGAGTCCTCCCAGAGTTCTCAAG ATTCCCAGCCTGTAGT

TCATGTAATTGCTTCCCGGCGTCAGGATTGGTCAGAACATGAGATTGCAATGGAGACTAGCCCCACCATAATATATCAGGATGTATCCAGTGAATCACAA

TCAGCCACTTCAACAATCAAAGCTCTGTTAGAACTCCAACAGACAACAG TAAAGGAAAAATTGGAATCTAAACCAAGACAACCCACTATTGACTTGAGT

CAAATGGCAGTACCTATTCAGATGACCCAGGAAAAGAGACATTCTCCTGAGAGTCCATCCATTGCTGTGGTAGAGTCAGAACTAGTTGCTGAATACATCA

CCACGG AACGCACTGATGAGGGGACAGAGGTTGCTTTTCCCCTTCTAG TCAGCCATCGCTCCCAGCCCCAACAGCCTTCCCAGCCCCAGCGGACCCTG

CTTCAACATGTGGCTCAGTCACAGACTGCGACGCAGACTTCGGTGGTAGTAAAGTCCATCCCAGCGTCTTCCCCTGGAGCAATCACCCACATCATGCAGC

AG GCATTAAGCAGTCACACCGCTTTTACGAAACACAGTGAGGAACTTGGAACTGAGGAGGGTGAGGTTGAAGAGATGGACACATTGGATCCTCAGACAG

GTCTGTTTTACCGCTCTGCCCTGACACAATCGCAGTCAACCAAACAGCAGAAACTTAGCCAGCCCCAGCTGGAACAGACTCAGCTGCAAGTGAAAACTCT

GCAGTGCTTCCAGACCAAACAGAAGCAGACCATCCACCTGCAGGCAGACCAACTCCAGCACAAACTCACACAGATGCCCCAGCTCTCTATCAGGCATCAG

AAACTGAATCCTCTCCAGCAGGAACAAGCACAGCCCAAGCCAGATGCACAGCACACACAGCATACTGTGGTGGCCAAAGACAGGCAGCTTCCTACCTTAA

TGGCACAGCCCCCGCAAACTGTAGTACAGGTGCTTGCCGTGAAAACCACACAGCAGCTTCCTAAACTGCAGCAAGCTCCGAACCAACCAAAAATCTACGT

GCAACCCCAAACTCCTCAGAGCCAGATGGCACTCCCCTCTTCAGAGAAACAGCCTGCAAGCCAG GCCATTCCCCAGTATGCTATTCCTTGTCACTCCAG

CTCCAATGTGGTGGTGGAGCCCAGTGGGCTTCTAGAGTTGAACAACTTCACCAGTCAGCAGCTAGATGACGACGAGACAGCCATGGAGCAGGACATAGAC

AGCAGCACGGAGGACGGGACTGAGCCCAGCCCCTCTCAGAGCGCTGTAGAACGGTCCTAGTGTGCAGACGCCGGAGTGCACTTTAGAGCCTGCGTGGTTA

CCAAATGTCCAGGGAAACTTAAAATTTGTTATAGT
Translation
 - UNI23152 - MPVVWPTLLDLSRDECKRILRKLE ELEAYAGVISALRAQGDLTKEKKDLLGELSKVLS SISTERHRAEVRRAVNDERLTTIAHK

 KMNLSLYLGERPSYS SMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAVQHNASLPVPAETASKDG GVSCSDEDEKPRKRRRTNSSSS

SPVVLKEVPKAVVPVSKTITVPVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQK VIIVTTSPSSTFVPNILSKSHNYAAVTKLVPTSV

IASTTQKPPVVITASQASLVTSSSNGNSSSTSSPISSTVAVTTVVSSTPSVVMSTVAQG GVSTSAIKVASTRLPSPKSLVSGPTQILAQFPKQHQQSPK

QQLQQVQQQTQQPVAQPSSVSQQQQPQQSALPPGIKPTIQIKQESG - UNI6041 - GVKIITQQVQPSKILPKPVTATLPTSSNSPIMVVSSNGAIM

TTKLVTTPTG GTQATYTRPTVSPSLGRVATTPGAATYVKTTSGSIITVVPKSLATLGGKIISSNIVSG GTTTKITTIPMTSKPNVIVVQKTTGKGTTI

QGLPGKNVVTTLLNAG - UNI8666 - GEKTLQTVPAGAKPAIITATRPITKMIVTQPKGIGSAVQPAAKIIPTKIVYGQQGKTQ - UNI9307 - 

VLIKPKPVTFQATVVSEQTRQLVTETLQQASRVADASNSSAQEGKEEPQGYTDSSSSSTESSQSSQD DSQPVVHVIASRRQDWSEHEIAMETSPTIIYQ

DVSSESQSATSTIKALLELQQTTV VKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTE ERTDEGTEVAFPLLV VSHRS

QPQQPSQPQRTLLQHVAQSQTATQTSVVVKSIPASSPGAITHIMQQ ALSSHTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSTKQQKLSQ

PQLEQTQLQVKTLQCFQTKQKQTIHLQADQLQHKLTQMPQLSIRHQKLNPLQQEQAQPKPDAQHTQHTVVAKDRQLPTLMAQPPQTVVQVLAVKTTQQLP

KLQQAPNQPKIYVQPQTPQSQMALPSSEKQPASQ AIPQYAIPCHSSSNVVVEPSGLLELNNFTSQQLDDDETAMEQDIDSSTEDGTEPSPSQSAVERS
Transcript ENSMUST00000107106
Sequence
CTTGCCCCTTCTGAGGCACCGCAAACAAACCTAATTCCTGGTGTCCCCTAGTCTTGGCGGAGGAGCCTTTTAGATGAGCCCCGAAAGGCCGGGCAG - U

NI23152 - GGAGGACAAGCTCTTTGGGGCTACCAGACAGAAGCAGCAATGCCTGTTGTGTGGCCAACCCTTTTGGATCTCAGCAGGGATGAATGCAAA

CGGATTCTTCGAAAATTGG AACTGGAGGCATATGCTGGAGTTATCAGTGCACTTCGGGCACAAGGGGACCTCACCAAGGAAAAGAAAGATCTTCTTGGA

GAGCTCTCAAAAGTCCTTAG CATCTCAACAGAGCGCCACCGTGCTGAAGTTCGGAGAGCAGTAAACGATGAACGGTTAACAACAATTGCACATAA TAT

GTCTGGACCTAATAGTTCTTCAGAGTGGTCCATCGAAGGACGTAGATTGGTACCTCTGATGCCCAGGCTGGTTCCCCAGACTGCCTTCACTGTAACAGCG

AATGCTGTGGCCAATGCAGCTGTCCAGCACAATGCGTCCCTTCCTGTGCCTGCAGAGACAGCAAGCAAAGACG GCGTTAGCTGCTCAGATGAAGATGAA

AAACCCAGAAAACGCAGGCGAACAAACTCCTCTAGCTCCTCCCCTGTTGTCCTCAAGGAAGTTCCAAAGGCTGTTGTTCCGGTCTCAAAGACGATCACTG

TGCCTGTGAGTGGAAGTCCCAAGATGAGCAACATTATGCAGAGCATTGCCAACTCCTTACCACCCCATATGTCACCTGTGAAAATAACGTTTACCAAACC

ATCAACACAGACAACAAACACAACAACACAGAAG GTTATTATAGTGACCACATCACCAAGTTCAACCTTTGTGCCCAACATTCTCTCCAAATCTCATAA

CTATGCAGCAGTCACTAAGCTTGTACCAACATCAGTCATTGCCTCCACGACTCAGAAGCCACCTGTTGTTATAACTGCGTCCCAGGCCTCTCTGGTCACC

AGTAGCAGCAATGGCAACAGCAGTTCTACGTCATCACCTATTTCTAGTACAGTTGCAGTAACAACGGTGGTATCTTCCACACCGTCCGTGGTCATGTCAA

CAGTAGCACAAG GTGTATCCACATCAGCAATCAAAGTGGCATCGACAAGACTTCCTTCCCCCAAAAGCTTAGTGAGTGGCCCTACCCAGATTCTTGCAC

AGTTTCCTAAACAGCATCAGCAGTCTCCTAAGCAGCAGTTACAGCAAGTACAACAACAGACACAGCAGCCAGTGGCCCAGCCTTCTTCAGTGTCTCAGCA

GCAGCAGCCTCAGCAGTCAGCATTGCCGCCTGGTATCAAACCTACCATCCAGATCAAACAGGAGTCAG - UNI6041 - GTGTTAAAATCATCACACA

GCAGGTTCAACCAAGTAAAATCTTACCCAAACCAGTGACTGCAACTCTACCCACCAGTAGCAATTCCCCAATTATGGTGGTTAGCAGTAATGGTGCAATT

ATGACAACTAAACTGGTAACCACTCCTACCG GTACTCAGGCAACCTATACCCGGCCAACAGTGAGCCCATCCTTAGGTCGTGTGGCTACAACCCCTGGA

GCTGCAACCTATGTGAAAACTACCAGTGGCAGCATCATCACTGTAGTACCCAAATCATTAGCTACCTTGGGAGGCAAGATAATTAGCAGTAATATTGTTT

CTG GAACGACTACCAAAATCACTACAATCCCAATGACTTCCAAGCCCAATGTGATTGTTGTACAAAAGACTACAGGAAAAGGAACGACCATTCAAGGCC

TCCCTGGCAAAAACGTTGTCACAACCTTGCTAAATGCTGGA - UNI8666 - GGAGAAAAGACTCTTCAGACAGTGCCAGCTGGAGCCAAGCCAGCTA

TAATTACTGCTACAAGACCCATCACCAAAATGATTGTAACACAGCCCAAAGGAATAGGTTCCGCAGTACAGCCAGCAGCTAAAATCATTCCAACAAAAAT

TGTGTATGGACAACAAGGGAAAACACAG - UNI9307 - GTTCTAATTAAACCCAAACCAGTGACATTTCAAGCTACAGTTGTCAGTGAACAAACAAG

GCAGCTGGTAACAGAAACATTACAGCAAGCATCCAGGGTAGCAGATGCCAGTAATTCATCTGCTCAGGAAGGAAAAGAGGAGCCACAGGGTTACACAGAC

AGTAGTTCTTCTTCCACAGAGTCCTCCCAGAGTTCTCAAG ATTCCCAGCCTGTAGTTCATGTAATTGCTTCCCGGCGTCAGGATTGGTCAGAACATGAG

ATTGCAATGGAGACTAGCCCCACCATAATATATCAGGATGTATCCAGTGAATCACAATCAGCCACTTCAACAATCAAAGCTCTGTTAGAACTCCAACAGA

CAACAG TAAAGGAAAAATTGGAATCTAAACCAAGACAACCCACTATTGACTTGAGTCAAATGGCAGTACCTATTCAGATGACCCAGGAAAAGAGACATT

CTCCTGAGAGTCCATCCATTGCTGTGGTAGAGTCAGAACTAGTTGCTGAATACATCACCACGG TCAGCCATCGCTCCCAGCCCCAACAGCCTTCCCAGC

CCCAGCGGACCCTGCTTCAACATGTGGCTCAGTCACAGACTGCGACGCAGACTTCGGTGGTAGTAAAGTCCATCCCAGCGTCTTCCCCTGGAGCAATCAC

CCACATCATGCAGCAG GCATTAAGCAGTCACACCGCTTTTACGAAACACAGTGAGGAACTTGGAACTGAGGAGGGTGAGGTTGAAGAGATGGACACATT

GGATCCTCAGACAGGTCTGTTTTACCGCTCTGCCCTGACACAATCGCAGTCAACCAAACAGCAGAAACTTAGCCAGCCCCAGCTGGAACAGACTCAGCTG

CAAGTGAAAACTCTGCAGTGCTTCCAGACCAAACAGAAGCAGACCATCCACCTGCAGGCAGACCAACTCCAGCACAAACTCACACAGATGCCCCAGCTCT

CTATCAGGCATCAGAAACTGAATCCTCTCCAGCAGGAACAAGCACAGCCCAAGCCAGATGCACAGCACACACAGCATACTGTGGTGGCCAAAGACAGGCA

GCTTCCTACCTTAATGGCACAGCCCCCGCAAACTGTAGTACAGGTGCTTGCCGTGAAAACCACACAGCAGCTTCCTAAACTGCAGCAAGCTCCGAACCAA

CCAAAAATCTACGTGCAACCCCAAACTCCTCAGAGCCAGATGGCACTCCCCTCTTCAGAGAAACAGCCTGCAAGCCAG GTGGAGCAGCCAATTATAACT

CAAGGATCCTCTGTTACAAAGATAACATTTGAGGGGCGCCAGCCTCCCACAGTTACAAAGATAACTGGTGGCAGTTCTGTTCCTAAGCTGACATCACCAG

TTACAAGCATATCTCCCATTCAGGCCTCTGAGAAGACAGCAGTGTCAGACATTTTGCAAATGTCTTTGATGGAAGCTCAGATTGATACAAATGTAGAACA

TATGGTAGTGGATCCCCCAAAGAAGGCTCTAGCCACCAATGTGCTCACTGGTGAGGCAGGAGCTCTACCCTCCACCCATGTGGTGGTGGCAGGGATGACG

AAATGTAGAGAGTCCTGTTCAAGTCCATCTGCTGTTGGCCCTCCCCTAACGACCAGAAAAATCGAAGCAGCAGGAGTGCCTACGACAGGCCAGTTCATGC

GTATTCAGAATGTAGGCCAAAAGAAAGCTGAAGAGAGCCCAACAGAAATTATCATCCAG GCCATTCCCCAGTATGCTATTCCTTGTCACTCCAGCTCCA

ATGTGGTGGTGGAGCCCAGTGGGCTTCTAGAGTTGAACAACTTCACCAGTCAGCAGCTAGATGACGACGAGACAGCCATGGAGCAGGACATAGACAGCAG

CACGGAGGACGGGACTGAGCCCAGCCCCTCTCAGAGCGCTGTAGAACGGTCCTAGTGTGCAGACGCCGGAGTGCACTTTAGAGCCTGCGTGGTTACCAAA

TGTCCAGGGAAACTTAAAATTTGTTATAGT
Translation
 - UNI23152 - MPVVWPTLLDLSRDECKRILRKLE ELEAYAGVISALRAQGDLTKEKKDLLGELSKVLS SISTERHRAEVRRAVNDERLTTIAHN

 NMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAVQHNASLPVPAETASKDG GVSCSDEDEKPRKRRRTNSSSSSPVVLKEVPKAVVPVS

KTITVPVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQK VIIVTTSPSSTFVPNILSKSHNYAAVTKLVPTSVIASTTQKPPVVITASQ

ASLVTSSSNGNSSSTSSPISSTVAVTTVVSSTPSVVMSTVAQG GVSTSAIKVASTRLPSPKSLVSGPTQILAQFPKQHQQSPKQQLQQVQQQTQQPVAQ

PSSVSQQQQPQQSALPPGIKPTIQIKQESG - UNI6041 - GVKIITQQVQPSKILPKPVTATLPTSSNSPIMVVSSNGAIMTTKLVTTPTG GTQAT

YTRPTVSPSLGRVATTPGAATYVKTTSGSIITVVPKSLATLGGKIISSNIVSG GTTTKITTIPMTSKPNVIVVQKTTGKGTTIQGLPGKNVVTTLLNAG

 - UNI8666 - GEKTLQTVPAGAKPAIITATRPITKMIVTQPKGIGSAVQPAAKIIPTKIVYGQQGKTQ - UNI9307 - VLIKPKPVTFQATVVS

EQTRQLVTETLQQASRVADASNSSAQEGKEEPQGYTDSSSSSTESSQSSQD DSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQSATSTIKAL

LELQQTTV VKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTV VSHRSQPQQPSQPQRTLLQHVAQSQTATQTSVVVKSI

PASSPGAITHIMQQ ALSSHTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSTKQQKLSQPQLEQTQLQVKTLQCFQTKQKQTIHLQADQLQ

HKLTQMPQLSIRHQKLNPLQQEQAQPKPDAQHTQHTVVAKDRQLPTLMAQPPQTVVQVLAVKTTQQLPKLQQAPNQPKIYVQPQTPQSQMALPSSEKQPA

SQ VEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILQMSLMEAQIDTNVEHMVVDPPKKALATNVLTGEAGALP

STHVVVAGMTKCRESCSSPSAVGPPLTTRKIEAAGVPTTGQFMRIQNVGQKKAEESPTEIIIQ AIPQYAIPCHSSSNVVVEPSGLLELNNFTSQQLDDD

ETAMEQDIDSSTEDGTEPSPSQSAVERS
Transcript ENSMUST00000038359
Sequence
CTTGCCCCTTCTGAGGCACCGCAAACAAACCTAATTCCTGGTGTCCCCTAGTCTTGGCGGAGGAGCCTTTTAGATGAGCCCCGAAAGGCCGGGCAG - U

NI23152 - GGAGGACAAGCTCTTTGGGGCTACCAGACAGAAGCAGCAATGCCTGTTGTGTGGCCAACCCTTTTGGATCTCAGCAGGGATGAATGCAAA

CGGATTCTTCGAAAATTGG AACTGGAGGCATATGCTGGAGTTATCAGTGCACTTCGGGCACAAGGGGACCTCACCAAGGAAAAGAAAGATCTTCTTGGA

GAGCTCTCAAAAGTCCTTAG CATCTCAACAGAGCGCCACCGTGCTGAAGTTCGGAGAGCAGTAAACGATGAACGGTTAACAACAATTGCACATAA AAT

GAATTTATCCTTATATTTGGGTGAAAGACCAAGTTACAG TATGTCTGGACCTAATAGTTCTTCAGAGTGGTCCATCGAAGGACGTAGATTGGTACCTCT

GATGCCCAGGCTGGTTCCCCAGACTGCCTTCACTGTAACAGCGAATGCTGTGGCCAATGCAGCTGTCCAGCACAATGCGTCCCTTCCTGTGCCTGCAGAG

ACAGCAAGCAAAGACG GCGTTAGCTGCTCAGATGAAGATGAAAAACCCAGAAAACGCAGGCGAACAAACTCCTCTAGCTCCTCCCCTGTTGTCCTCAAG

GAAGTTCCAAAGGCTGTTGTTCCGGTCTCAAAGACGATCACTGTGCCTGTGAGTGGAAGTCCCAAGATGAGCAACATTATGCAGAGCATTGCCAACTCCT

TACCACCCCATATGTCACCTGTGAAAATAACGTTTACCAAACCATCAACACAGACAACAAACACAACAACACAGAAG GTTATTATAGTGACCACATCAC

CAAGTTCAACCTTTGTGCCCAACATTCTCTCCAAATCTCATAACTATGCAGCAGTCACTAAGCTTGTACCAACATCAGTCATTGCCTCCACGACTCAGAA

GCCACCTGTTGTTATAACTGCGTCCCAGGCCTCTCTGGTCACCAGTAGCAGCAATGGCAACAGCAGTTCTACGTCATCACCTATTTCTAGTACAGTTGCA

GTAACAACGGTGGTATCTTCCACACCGTCCGTGGTCATGTCAACAGTAGCACAAG GTGTATCCACATCAGCAATCAAAGTGGCATCGACAAGACTTCCT

TCCCCCAAAAGCTTAGTGAGTGGCCCTACCCAGATTCTTGCACAGTTTCCTAAACAGCATCAGCAGTCTCCTAAGCAGCAGTTACAGCAAGTACAACAAC

AGACACAGCAGCCAGTGGCCCAGCCTTCTTCAGTGTCTCAGCAGCAGCAGCCTCAGCAGTCAGCATTGCCGCCTGGTATCAAACCTACCATCCAGATCAA

ACAGGAGTCAG - UNI6041 - GTGTTAAAATCATCACACAGCAGGTTCAACCAAGTAAAATCTTACCCAAACCAGTGACTGCAACTCTACCCACCAG

TAGCAATTCCCCAATTATGGTGGTTAGCAGTAATGGTGCAATTATGACAACTAAACTGGTAACCACTCCTACCG GTACTCAGGCAACCTATACCCGGCC

AACAGTGAGCCCATCCTTAGGTCGTGTGGCTACAACCCCTGGAGCTGCAACCTATGTGAAAACTACCAGTGGCAGCATCATCACTGTAGTACCCAAATCA

TTAGCTACCTTGGGAGGCAAGATAATTAGCAGTAATATTGTTTCTG GAACGACTACCAAAATCACTACAATCCCAATGACTTCCAAGCCCAATGTGATT

GTTGTACAAAAGACTACAGGAAAAGGAACGACCATTCAAGGCCTCCCTGGCAAAAACGTTGTCACAACCTTGCTAAATGCTGGA - UNI8666 - GGA

GAAAAGACTCTTCAGACAGTGCCAGCTGGAGCCAAGCCAGCTATAATTACTGCTACAAGACCCATCACCAAAATGATTGTAACACAGCCCAAAGGAATAG

GTTCCGCAGTACAGCCAGCAGCTAAAATCATTCCAACAAAAATTGTGTATGGACAACAAGGGAAAACACAG - UNI9307 - GTTCTAATTAAACCCA

AACCAGTGACATTTCAAGCTACAGTTGTCAGTGAACAAACAAGGCAGCTGGTAACAGAAACATTACAGCAAGCATCCAGGGTAGCAGATGCCAGTAATTC

ATCTGCTCAGGAAGGAAAAGAGGAGCCACAGGGTTACACAGACAGTAGTTCTTCTTCCACAGAGTCCTCCCAGAGTTCTCAAG ATTCCCAGCCTGTAGT

TCATGTAATTGCTTCCCGGCGTCAGGATTGGTCAGAACATGAGATTGCAATGGAGACTAGCCCCACCATAATATATCAGGATGTATCCAGTGAATCACAA

TCAGCCACTTCAACAATCAAAGCTCTGTTAGAACTCCAACAGACAACAG TAAAGGAAAAATTGGAATCTAAACCAAGACAACCCACTATTGACTTGAGT

CAAATGGCAGTACCTATTCAGATGACCCAGGAAAAGAGACATTCTCCTGAGAGTCCATCCATTGCTGTGGTAGAGTCAGAACTAGTTGCTGAATACATCA

CCACGG TCAGCCATCGCTCCCAGCCCCAACAGCCTTCCCAGCCCCAGCGGACCCTGCTTCAACATGTGGCTCAGTCACAGACTGCGACGCAGACTTCGG

TGGTAGTAAAGTCCATCCCAGCGTCTTCCCCTGGAGCAATCACCCACATCATGCAGCAG GCATTAAGCAGTCACACCGCTTTTACGAAACACAGTGAGG

AACTTGGAACTGAGGAGGGTGAGGTTGAAGAGATGGACACATTGGATCCTCAGACAGGTCTGTTTTACCGCTCTGCCCTGACACAATCGCAGTCAACCAA

ACAGCAGAAACTTAGCCAGCCCCAGCTGGAACAGACTCAGCTGCAAGTGAAAACTCTGCAGTGCTTCCAGACCAAACAGAAGCAGACCATCCACCTGCAG

GCAGACCAACTCCAGCACAAACTCACACAGATGCCCCAGCTCTCTATCAGGCATCAGAAACTGAATCCTCTCCAGCAGGAACAAGCACAGCCCAAGCCAG

ATGCACAGCACACACAGCATACTGTGGTGGCCAAAGACAGGCAGCTTCCTACCTTAATGGCACAGCCCCCGCAAACTGTAGTACAGGTGCTTGCCGTGAA

AACCACACAGCAGCTTCCTAAACTGCAGCAAGCTCCGAACCAACCAAAAATCTACGTGCAACCCCAAACTCCTCAGAGCCAGATGGCACTCCCCTCTTCA

GAGAAACAGCCTGCAAGCCAG GTGGAGCAGCCAATTATAACTCAAGGATCCTCTGTTACAAAGATAACATTTGAGGGGCGCCAGCCTCCCACAGTTACA

AAGATAACTGGTGGCAGTTCTGTTCCTAAGCTGACATCACCAGTTACAAGCATATCTCCCATTCAGGCCTCTGAGAAGACAGCAGTGTCAGACATTTTGC

AAATGTCTTTGATGGAAGCTCAGATTGATACAAATGTAGAACATATGGTAGTGGATCCCCCAAAGAAGGCTCTAGCCACCAATGTGCTCACTGGTGAGGC

AGGAGCTCTACCCTCCACCCATGTGGTGGTGGCAGGGATGACGAAATGTAGAGAGTCCTGTTCAAGTCCATCTGCTGTTGGCCCTCCCCTAACGACCAGA

AAAATCGAAGCAGCAGGAGTGCCTACGACAGGCCAGTTCATGCGTATTCAGAATGTAGGCCAAAAGAAAGCTGAAGAGAGCCCAACAGAAATTATCATCC

AG GCCATTCCCCAGTATGCTATTCCTTGTCACTCCAGCTCCAATGTGGTGGTGGAGCCCAGTGGGCTTCTAGAGTTGAACAACTTCACCAGTCAGCAGC

TAGATGACGACGAGACAGCCATGGAGCAGGACATAGACAGCAGCACGGAGGACGGGACTGAGCCCAGCCCCTCTCAGAGCGCTGTAGAACGGTCCTAGTG

TGCAGACGCCGGAGTGCACTTTAGAGCCTGCGTGGTTACCAAATGTCCAGGGAAACTTAAAATTTGTTATAGT
Translation
 - UNI23152 - MPVVWPTLLDLSRDECKRILRKLE ELEAYAGVISALRAQGDLTKEKKDLLGELSKVLS SISTERHRAEVRRAVNDERLTTIAHK

 KMNLSLYLGERPSYS SMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAVQHNASLPVPAETASKDG GVSCSDEDEKPRKRRRTNSSSS

SPVVLKEVPKAVVPVSKTITVPVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQK VIIVTTSPSSTFVPNILSKSHNYAAVTKLVPTSV

IASTTQKPPVVITASQASLVTSSSNGNSSSTSSPISSTVAVTTVVSSTPSVVMSTVAQG GVSTSAIKVASTRLPSPKSLVSGPTQILAQFPKQHQQSPK

QQLQQVQQQTQQPVAQPSSVSQQQQPQQSALPPGIKPTIQIKQESG - UNI6041 - GVKIITQQVQPSKILPKPVTATLPTSSNSPIMVVSSNGAIM

TTKLVTTPTG GTQATYTRPTVSPSLGRVATTPGAATYVKTTSGSIITVVPKSLATLGGKIISSNIVSG GTTTKITTIPMTSKPNVIVVQKTTGKGTTI

QGLPGKNVVTTLLNAG - UNI8666 - GEKTLQTVPAGAKPAIITATRPITKMIVTQPKGIGSAVQPAAKIIPTKIVYGQQGKTQ - UNI9307 - 

VLIKPKPVTFQATVVSEQTRQLVTETLQQASRVADASNSSAQEGKEEPQGYTDSSSSSTESSQSSQD DSQPVVHVIASRRQDWSEHEIAMETSPTIIYQ

DVSSESQSATSTIKALLELQQTTV VKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTV VSHRSQPQQPSQPQRTLLQHV

AQSQTATQTSVVVKSIPASSPGAITHIMQQ ALSSHTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSTKQQKLSQPQLEQTQLQVKTLQCF

QTKQKQTIHLQADQLQHKLTQMPQLSIRHQKLNPLQQEQAQPKPDAQHTQHTVVAKDRQLPTLMAQPPQTVVQVLAVKTTQQLPKLQQAPNQPKIYVQPQ

TPQSQMALPSSEKQPASQ VEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILQMSLMEAQIDTNVEHMVVDPPK

KALATNVLTGEAGALPSTHVVVAGMTKCRESCSSPSAVGPPLTTRKIEAAGVPTTGQFMRIQNVGQKKAEESPTEIIIQ AIPQYAIPCHSSSNVVVEPS

GLLELNNFTSQQLDDDETAMEQDIDSSTEDGTEPSPSQSAVERS

For any suggestions or comments, please send an email to unitrap@crg.es