Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035403 (Crb2)
Chromosomal location
Chr 2: 37631861 - 37654619 (+)
Description
crumbs homolog 2 (Drosophila) Gene [Source:MGI (curated);Acc:Crb2-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37255
Vector Insertion
Chr 2: 37642378 - 37642783
Public Clones CMHD-GT_484D7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050372
Sequence
ATGGCGCTGGTGGGGCCTAGGATTTGGGGCCCTAGACGAGATATTTACCCCCTGTTGCTGCTACTGCTACTGCTGCTGCTGCTGCTGCTGCCTTGGGTCC

CGGCTG GGCTGGTTCCTCCAGAGACTCCAAGTGTCTGTGCCTCAGACCCATGTGCTCCAGGGACCAAGTGCCAGGCTACAGAAAGTGGTGGCTATACCT

GTGAGCCCTCAGAGCTTGGAGGCTGTGCTACTCAGCCATGCCACCACGGGGCACTGTGTGTGCCCCAGGGCCCAGATCCTAACAGCTTCCGTTGCTACTG

TGTGCCTGGATTCCAGGGACCCCACTGTGAACTGGACATCGATGAGTGTGCGTCCCGGCCTTGCCAGCATGGGGGCACCTGCCAAAATCTGGCAGATCAC

TACGAGTGCCACTGTCCCCTGGGATATGCAG GCGTGACCTGTGAGGCCGAGGTGGACGAGTGCTCGTCAGCGCCCTGCCTGCACGGAGGCTCGTGCCTG

GACGGTGTGGGTTCCTACCGCTGCGTGTGCGCGCCGGGATACGCCGGTGCGAACTGTCAGCTGGACGTGGACGAGTGCCAGAGCCAGCCGTGCGCGCACG

GTGGCGTGTGTCACGACCTGGTCAACGG TTTCCGGTGCGACTGCGCGGACACGGGTTACGAAGGCGCGCGCTGCGAGCAGGAGGTGCTGGAGTGCGCCT

CTGCGCCCTGCGCGCACAACGCGTCCTGCCTCGACGGCTTCCGGAGCTTCCGCTGCCTCTGCTGGCCAG - UNI37255 - GCTTCAGTGGAGAGCGG

TGCGAAGTGGATGAGGACGAATGTGCATCGGGCCCCTGTCAAAATGGGGGCCAGTGCTTGCAGCGCTCTGACCCGACCTTGTACGGGGGTGTTCAGGCCA

TCTTCCCGGGAGCCTTCAGCTTCAGCCACGCCGCTGGCTTCCTTTGCAGCTGTCCTCTGGGCTTTGCTG GGAATGACTGCAGCATGGATGTGGATGAGT

GTGCCTCAGGGCCGTGCCTCAATGGAGGTAGCTGCCAGGACCTGCCCAATGGTTTCCAGTGCTACTGCCAGGATGGATACACAG GCCTGACATGTCAGG

AAGATATGGATGAATGCCAGTCGGAACCATGCCTGCATGGTGGAACCTGCAGCGACACTGTAGCAGGCTACATCTGCCAGTGCCCTGAGGCCTGGGGTGG

ACATGACTGTTCTGTGCAGCTCACAGGCTGCCAGGGCCATACCTGCCCACTGGCTGCCACCTGCATCCCCACCTTCAAGTCTGGCCTCCACGGTTACTTC

TGCCGCTGCCCACCGGGGACCTATGGGCCTTTCTGTGGCCAGAATACGACCTTCTCGGTTGTGTCTGGGAGTTCTGTGTGGGGATTGGTGCCAGCTGCTG

CCTCCCTGGGTCTGGCACTGAGATTTCGTACCACCCTGCTTGCCGGAACCCTGGCTACTCTCAAAGACACTCGGGACAGCTTGGAGCTGGTTCTGGTGGG

GGCCGTGCTCCAAGCCACACTCTCGAGACATGGCACTGCGGTGCTCATCCTTACACTGCCTGACCTAGCCTTAAATGATGGGCATTGGCACCAGGTGGAA

GTGACGCTCCACCTGGGAACCCTGGAGCTGCGGCTCTGGCACGAGGGCTGCCCTGGCCAGCTCTGTGTGGCCTCTGGTCCGGTGGCTACAGGCCCTACAG

CCTCGGTGGCCTCTGGGCCTCCGGGATCCTACTCCATCTATCTGGGCGGCGGGGTCTTTGCCGGCTGCTTCCAGGATGTGCGTGTGGAAGGGCACCTTCT

GCTGCCTGAGGAGCTCAAGGGAACTGTGCTTCTGGGTTGTGAGCGCAGGGAACCTTGCCAGCCTCTGCCTTGTGCCCATGGAGGGGCCTGCGTGGACCTG

TGGACTCACTTCCGCTGCGACTGCCCGAGACCTTACCGTGGAGCCACATGCACTGATG AGGTTCCTGCTGCCACTTTTGGCTTGGGTGGAGCCACGAGC

TCAGCCTCTTTTCTGCTCCACCAACTAGGCCCAAACCTCACCGTGTCATTTTTCCTCCGCACCCGCGAACCTGCCGGCCTGTTGCTCCAGTTTGCCAATG

ATTCAGTTGCGAGCCTGACTGTGTTCCTGAGTGAGGGCCAGATCCGGGCTGAGGGGCTGGGTCACCCTGCTGTGGTCCTCCCTGGGCGCTGGGATGATGG

ACTCCCCCACTTGGTGATGCTCAGCTTTGGGCCTGACCAGCTGCAGGACCTGGGCCAGCGGCTGTATGTGGGTGGGAGGTTCTACCCTGATGACACCCAG

CTCTGGGGTGGGCCCTTCCGAGGCTGTCTCCAGGACCTACAACTCAACAGCATCCACCTCCCCTTCTTCTCTTCCCCGATGGAGAACTCAAGTTGGCCCA

GTGAACTGGAAGCTGGCCAGTCCTCCAACCTCACCCAGGGTTGTGTCTCTGAGGACACGTGCAAT CCCAATCCCTGTTTCAATGGTGGCACGTGCCACG

TCACCTGGAATGACTTCTACTGCACCTGCTCCGAGAACTTCACGGGGCCCACCTGTGCCCAGCAGCGATGGTGCCCCAGGCAGCCATGCCTGCCTCCTGC

CACCTGTGAGGAGGTTCCAGATGGCTTTGTGT GTGTGGCCGAGGCCACGTTCCGCGAGGGCCCTCCTGCTGTGTTCACAGGCCACAACGTGTCCTCATC

GCTCAGCGGGCTCACCCTGGCCTTCCGCACGCGCGACTCCGAGGCTGGGCTACTGCGCGCCGTCTCCGCCGCAGGTGCCCACTCCAATATCTGGTTGGCG

GTGCGCAACGGCTCGCTGGCAGGAGATGTGGCGGGTTCGGTGCTGCCCGCGCCCGGGCCGCGCGTGGCCGACGGCGCCTGGCATCGCGTGCGCCTAGCCC

GGGAGTTCCCACAGGCCGCTGCCTCGCGCTGGCTGCTGTGGCTGGACGGCGCGGCGACACCCGTGGCCTTGCACGGCTTGGGCGGCGACCTGGGCTTTCT

GCAGGGTCCGGGTGCAGTGCCTCTGCTACTGGCTGAGAACTTCACGGGCTGCCTGGGCCGCGTGGCACTTGGCGACTTCCCGTTACCCTTGGCGCCACCG

CGGTCTGGCACGGTGTCTGGGGCGCGCGAGCACTTCGTGGCCTGGCCCGGGTCTCCGGCCGTGAGTCTCGGCTGCCGTGGCGGACCCGTATGTTCACCCT

CGCCCTGCCTGCACGGTGGCGCCTGCCGCGACCTCTTCGACGCCTTTGCTTGCTCCTGCGGCCCCGCCTGGGAAGGACCCCGCTGCGAGATCCGCGCTGA

CCCATGTCGCTCCACTCCCTGTGTCCGGGGCCAATGCCATGCGCGCCCCGACGGCCGCTTCGAGTGTCGCTGCCCTCCGGGCTTCTCCGGCCCGCGCTGC

AG GTTGCCTGTCCTGCCTCAGGGATGCAACCTCAACTCCACATGCAAGGATGGCGCCCCTTGTGAAGGCGGCCCCTTAGGCACCAACTGCAGTTGCCAG

GAAGGTCTTGCTGGCCTCAG ATGTCAGAGTCTCGACAAACCCTGTGAAGCCAGCCCTTGCTTGAATGGGGGCACTTGCCGGGTGGCCAGTGGCATATTT

GAATGTACTTGCAGTGCAGGATTCTCTGGCCAGTTCTGTGAAGTGGTG AAAACCCTACCTCTGCCTCTGCCGTTCCCACTGCTGGAGGTAGCAGTGCCT

GCAGCCTGTGCCTGCCTCCTCCTTCTCCTCCTGGGCCTCCTCTCAGGAATCCTGGCTGCCAGAAAGCGCCGCCAGTCTGAGGGCACTTACAGCCCAAGTC

AGCAGGAGGTGGCTGGGGCTCGTCTGGAGATGGACAGTGTCCTCAAGGTGCCACCAGAGGAGAGACTTATTTAGGTTTGCCTGGCTGCTGGTGCCATGTC

CTGAAGGTCCTAAAGGGTCACCACAGGACTTCTACCTGGAGACCCAAGGAGACTGTTTCCAGAGCTGGGACATCCACAGGATGTGCCCCCATGGTTGGCA

GCCCTTGCTCTGTCCATCATGGACTCAGGAAATGGGGAACAACTCAGGGAAGCAGAGGAGGCTGTGAGAGTGTGTACTTCTCTGACCTGCTGGGCTGGAT

ACAGGGCACATGTTGGTGCCCATGATATGACAGGGTGTGTGCATGTGCTTCTGTGCATATGTGTTTGTGTATGTGTGTGCATCTTTCTGTTTGGGGAAGA

GGAGGAAAGAGAGAGGAGAAGGAGAAGGAGACTATACATAGGGATGTGTTGGTCTGCAGATTGTAATGTGTTATGACTGTGGTAAGGGCTTCATGTCTGG

GAACCACCCAGATGGTTACCTCTGGGACAGGGGCAGCCCAAGGCTGCACGTTCTCTAGCACTGGACAGGCCAGAGCTTACCCAAGCACCTAGACTTTGGT

CTTGACATCTTGTTCAACCTCCAAGAACAGCCAGAAGCTGGGATAGGGAGGAGTCTCCTTGGTTTCCAGAACAAAAGCCCTTTGGGCAGGTCTGTAGGAA

CCAAGGAGCGGCTGCCCTGGGTTGCCCTGCCTGCTGTGGGCATTTGCCAGAGTGGAGCAACCAACCTGTCTGCCTACCTCACATCACACGGCTATTCTGA

GGATCCGAGAGACAAACAGGCAGAAAACTCCAGTCTGGTGGGAAGAACTGGCTGCCCTTGGGTGTTGGAAAGTGTCTTGCCCACCTAGAGTTGAAAAGGC

TTCTTGGGACCCTAGCAAGAAGGCCAGAGAGGTGGAAGAACGGAGATGCTATTATCTTCTGTCCCTGACCCCTGCAAACTCACCCCTTTGCCTGCAGTTC

TGTTGCCAAGGAAGGCTCTGTTGTGTGCCAAACAACAGTGTCCAGCAGATGGACATCAGGCAGCTTCTGCATTGGCGCTCAGGCTGCAGAAGCCGATTAC

ATCCTGTGGACACTCAGTGCAAGTGACTTCTGACAACTCCTCTCCCAGGGCATTGGCCTGAAGGTTTAGCCTCCCTTGAACTTTCCAGAGGCCTCTGACT

TGGAGATGTGTCCTTTGTCATCTTTGTTTATCAGGCAGTGCCTTCTCACAGGAGTTCCCATGTGCAAACGCCAGGTGACTTTTACACAAGGAAGCTCGGT

GTCTCCAGGTTTCAGCTGCCTCCCAAGGCACAGACTTGGGGGAACCAGGAGATCAGTAGAAGCTTTGTTAAGAGACCCTGGATGCTAAGCGAGAAGGCCT

ACTTGGTTCTTACTCTGTAGTGGTGAGGCCACTTTGCCCCGAGCTATCTCCATGCCCCTTGGGAGAGGGGAGAGGAAACAGGCTCTTGGGTGAACTGTTT

CAGTTGCCAGCTCCTAAGATGATTCTTGTGGAATGCCAACGGAACGAAACATCCCAGTTCCACGTCAGTGTCACCAATGTGGCCTACACAAGTACTCTCA

CTTGGGGGAGATGGTGTTCTTGCTGAGACAAGGGGGAGGAGTGGAGCTTGTTCCTTTGTGTAGTCCTGCCCATGATGTAGTGTCCACTATGATTCCCTCA

TGGGGAGGGATGGTGTAAGTGGCTCAGAGCCTCAAGCATGCATAGGCTGGAGGACAGTGGCCTCTGCTTCTGCAGGATGGCTGGTGGAGGTGGCCAAGTG

CCTGCTCAGGCAGCCATCCCCCAGAGCTCCTTGTAGGACTCAGGACTACAGCCCTCTCCCCAGTTTTATTGACCACATATAGAATTCATCGTTGGATTGC

AAAGTCTACCCAGTGAAATGGACAGATGACAACAAACATGTGAACTACAGGTGTGTGCCTTCTTAGGCTGCCCGACACCCTGTCACCCTATTGGCCCACT

AGGCTGTGGCACTGCCTCATCTTGGGTGGAACCCGGAATTTGTTAGGATGGAGGAAGTGGGGCTGAGGCCTGTCCTGGGACACCAGAATGCCAGAAGGCT

TCCCACGACCCAGTGAGACTCCGCTCCCTGGTAGCTGAGCACACCACCAAGACAGAGCCCTGGGGAAGGAGGGCTACCTCTCTGGCCTAGACCTCAGGGA

CCCATAAACAACCTCTCAGACAGAGAGGGTCCCTAAAGTAACAGGTACCTCTGATGACCCCACCCCCTTGTTCCCAACCCCCAGAAACCCTGGGGTAGGC

TGTCTGACCATTTACACATAGGAAATGAGAAATCAGGTCAAATGTGCACAATTTCCTGCATGTCTCTGATGGATGTTTTCTTAAACGGTCAGTCTGTGTT

TTACCTTGGTTTATTGAAAGGAATCAATTTTCAAGATTCATCAAATCAATAAGGTAAAAAGGAAAAGCAAGATCAAAGAAAAAATAACAAAACATTTCAT

T
Translation
MALVGPRIWGPRRDIYPLLLLLLLLLLLLLPWVPAG GLVPPETPSVCASDPCAPGTKCQATESGGYTCEPSELGGCATQPCHHGALCVPQGPDPNSFRC

YCVPGFQGPHCELDIDECASRPCQHGGTCQNLADHYECHCPLGYAG GVTCEAEVDECSSAPCLHGGSCLDGVGSYRCVCAPGYAGANCQLDVDECQSQP

CAHGGVCHDLVNG GFRCDCADTGYEGARCEQEVLECASAPCAHNASCLDGFRSFRCLCWPG - UNI37255 - GFSGERCEVDEDECASGPCQNGGQ

CLQRSDPTLYGGVQAIFPGAFSFSHAAGFLCSCPLGFAG GNDCSMDVDECASGPCLNGGSCQDLPNGFQCYCQDGYTG GLTCQEDMDECQSEPCLHGG

TCSDTVAGYICQCPEAWGGHDCSVQLTGCQGHTCPLAATCIPTFKSGLHGYFCRCPPGTYGPFCGQNTTFSVVSGSSVWGLVPAAASLGLALRFRTTLLA

GTLATLKDTRDSLELVLVGAVLQATLSRHGTAVLILTLPDLALNDGHWHQVEVTLHLGTLELRLWHEGCPGQLCVASGPVATGPTASVASGPPGSYSIYL

GGGVFAGCFQDVRVEGHLLLPEELKGTVLLGCERREPCQPLPCAHGGACVDLWTHFRCDCPRPYRGATCTDE EVPAATFGLGGATSSASFLLHQLGPNL

TVSFFLRTREPAGLLLQFANDSVASLTVFLSEGQIRAEGLGHPAVVLPGRWDDGLPHLVMLSFGPDQLQDLGQRLYVGGRFYPDDTQLWGGPFRGCLQDL

QLNSIHLPFFSSPMENSSWPSELEAGQSSNLTQGCVSEDTCN PNPCFNGGTCHVTWNDFYCTCSENFTGPTCAQQRWCPRQPCLPPATCEEVPDGFVC 

CVAEATFREGPPAVFTGHNVSSSLSGLTLAFRTRDSEAGLLRAVSAAGAHSNIWLAVRNGSLAGDVAGSVLPAPGPRVADGAWHRVRLAREFPQAAASRW

LLWLDGAATPVALHGLGGDLGFLQGPGAVPLLLAENFTGCLGRVALGDFPLPLAPPRSGTVSGAREHFVAWPGSPAVSLGCRGGPVCSPSPCLHGGACRD

LFDAFACSCGPAWEGPRCEIRADPCRSTPCVRGQCHARPDGRFECRCPPGFSGPRCR RLPVLPQGCNLNSTCKDGAPCEGGPLGTNCSCQEGLAGLR R

CQSLDKPCEASPCLNGGTCRVASGIFECTCSAGFSGQFCEVV KTLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQQEVAGA

RLEMDSVLKVPPEERLI

For any suggestions or comments, please send an email to unitrap@crg.es