Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035427 (CN716893)
Chromosomal location
Chr X: 83495595 - 83550432 (-)
Description
Novel protein containing a MAGE family domain (MCG1035418) (Expressed sequence CN716893)  [Source:UniProtKB/TrEMBL;Acc:A2A9R3]
Human Ortholog
not available
Omim not available
UniTrap UNI35220
Vector Insertion
Chr X: 83501466 - 83550433
Public Clones IST13422G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113969
Sequence
GAGGAGAAGGAGGAGGTGGAGGAGAAGCTGCTGCCGCCACTGCTGCTGTGTCCGCCTGCTCTGCTGAGGGGGAATTTCGCTTAGCAATCAAG - UNI35

220 - GCTCGAGGACCCATCTCCCTGGTAGAAGGAGAAAACCAACTGTGGTTGCCAACTTACGCCCACGCGGCTTGAGTCCCCCAAG GTCCCAAAAGT

ACTTGATTTCCAGACCACACTCCTATCTGCTGTCTCTTGCCACAGCCATCATGCCCAGGGGACAAAAGAGTAAGGCCCGTGCTCGTGAGAAGCGTCGCCT

GGTCCAGGATGAGGCCCAGGAGCTCCAGGATGCTCAAGCCAAGGCAGGAGAGAAAGGAAAGTCCCCCTCCTGCTCTAATCAGGATTCTGGAGATGCTGTT

GCAAGCACCTCTACTGCTGGCTTCCCTCAAAAGTCTAAATCTCAAGGTGAGGCACCCACCACCACTGCTAGGAAAGGTGGTGCCTGCAGAAGATCTCGTA

AAAGTACCAGAGGTCCAAGGGAGGAAAGTACCAGTTGCACTAGGGTCCCCCGCTTCAGTGAGAATCCACAGAATGATCTTCTAACAAGGAAGACAGGAAT

GCTGATGCAGTACCTGCTCTGCAAGTACAAAATGAAACAGCCAGCATCTAAGGGAGAAATGCTCAAAGTGATCAACAGAAGGTTCAAGGAGCAGTTGCCT

GAGATCCTCAAGAAAGCCTCTGAGCGCATTCAGCTAGTTTTTGGTCTTGAGGTGAAAGAAATTAAGCCCAATGGTGGCTACTACACCCTTGTTAGCAAGT

TAGATCCCAGTGTCGGTAATGCTCTGACCACTAGCCTGCCATTTCCCCAGAACGGGCTTTTGATGCCTCTTCTGGGTGTGATCTTCTTAAATGGCAACCG

TGCCTCTGAGGCAGAGATCTGGGAATTCCTTAATGTCTTGGGAATTTATGATGGGAAGGTGCACATAATCTTTGGGGAGCCCCGGAAGCTCATCACCAGA

GATCTGGTTAAGGAAAAGTACCTGGTATACCAAAAGGAGGCCAACAGTGATCCCCCATCCTTTGAGTTCCTTTGGGGTCCCCGAGCCTATGCTGAAACTA

CCAAGATGAAAATCCTGGAGTTTTTAGCCGAGGTCAATGAGACCGTTCCTCAGGCCTTCCCAACCCATTATGAGGAGGCTTTGAGAGATCAGGAAGAGAG

AGCCCAAGCCGAAGCTGTAGGCAGTCCTGGCACTAGTGCCAAAGATAAGGCAGAGGCTAAAGTCACACTGGTTGACTCCTCTTGCAAATATCAGGCTGAG

TCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGATCAGGCTGAGTCTAAAGTCACACTTGTTGACCCCTCTTGCAAAGATAATGCCAAGTCTAAGGTCA

CACTTGGCTCCTCTCGCAAATACAAGGCCAAGTCTAAAGTCCCACTGGTTGACTCCTCTTGCAAAGATCAGGCTGAGTCTAAAGTCACACTTGTGGACTC

TTGCAAAGATCAGGCTGAGTCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGATCAGGCTGAGTCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGAT

CAGGCTGAGTCTAAAGTCACACTTGTTGACCCCTCTTGCAAAGATAAGGCCAAGTCTAAGGTCACACTTGGCTCCTCTCACAAATACAAGGCCAAGTCTA

AAGTCACACTGGTTGACTCCTCTTGCAAAGATCAGGCTGAGTCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGATCAGGCTGAGTCTAAAGTCACACT

TGTTGACCCCTCTTGCAAAGATAATGCCAAGTCTAAGGTCACACTTGGCTCCTCTCGCAAATACAAGGCCAAGTCTAAAGTCCCACTGGTTGACTCCTCT

GGAAAAGATAAGGCAGTCTAAAGTCGTACCTGACTCCTCTTGCTCCTGCAGAGATGAGAGGCAGATATGTCTTTAGGTTTAGAACAGGGTTTTTCACCTT

AAAAGTAGTGAGAGGTTGATAGTTCATAATACACATCTTATTGTGCTTTAGTTTATACCTTAGTCTTTTTAAGTGTTTCTCTTTTCTTAGAATCCTTATA

TAGGTTCAGGACTCACAGGTATAAATTACCTATATCAGTTATTGCTGTAAGATTTTAAGTATAAGAATTTTGGTATTCTGTATTACACTGTTAAAACCCT

GGAATCTTTAAGTTGATGAGCAAGCACCCATTACTTTGTAACGAAAGGAGCATTTCTTTGAAACATGTGAGAGAGTAATTTGTTTCTTAAGATAGACGAA

AACAAAGAGAAATGTGTAAACCGTCATTTTCCCTTATTCACTGTGTTTTTATTTCACTTTTTGGTAAAGTTTGAAGACATGTACTCAGTTGTTGTTAACT

GAATAAAATTGCAAAC
Translation
 - UNI35220 -  MPRGQKSKARAREKRRLVQDEAQELQDAQAKAGEKGKSPSCSNQDSGDAVASTSTAGFPQKSKSQGEAPTTTARKGGACRRSRKS

TRGPREESTSCTRVPRFSENPQNDLLTRKTGMLMQYLLCKYKMKQPASKGEMLKVINRRFKEQLPEILKKASERIQLVFGLEVKEIKPNGGYYTLVSKLD

PSVGNALTTSLPFPQNGLLMPLLGVIFLNGNRASEAEIWEFLNVLGIYDGKVHIIFGEPRKLITRDLVKEKYLVYQKEANSDPPSFEFLWGPRAYAETTK

MKILEFLAEVNETVPQAFPTHYEEALRDQEERAQAEAVGSPGTSAKDKAEAKVTLVDSSCKYQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTL

GSSRKYKAKSKVPLVDSSCKDQAESKVTLVDSCKDQAESKVTLVDSSCKDQAESKVTLVDSSCKDQAESKVTLVDPSCKDKAKSKVTLGSSHKYKAKSKV

TLVDSSCKDQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTLGSSRKYKAKSKVPLVDSSGKDKAV
Transcript ENSMUST00000096378
Sequence
GAGGAGAAGGAGGAGGTGGAGGAGAAGCTGCTGCCGCCACTGCTGCTGTGTCCGCCTGCTCTGCTGAGGGGGAATTTCGCTTAGCAATCAAG - UNI35

220 - GCTCGAGGACCCATCTCCCTGGTAGAAGGAGAAAACCAACTGTGGTTGCCAACTTACGCCCACGCGGCTTGAGTCCCCCAAG GTCCCAAAAGT

ACTTGATTTCCAGACCACACTCCTATCTGCTGTCTCTTGCCACAGCCATCATGCCCAGGGGACAAAAGAGTAAGGCCCGTGCTCGTGAGAAGCGTCGCCT

GGTCCAGGATGAGGCCCAGGAGCTCCAGGATGCTCAAGCCAAGGCAGGAGAGAAAGGAAAGTCCCCCTCCTGCTCTAATCAGGATTCTGGAGATGCTGTT

GCAAGCACCTCTACTGCTGGCTTCCCTCAAAAGTCTAAATCTCAAGGTGAGGCACCCACCACCACTGCTAGGAAAGGTGGTGCCTGCAGAAGATCTCGTA

AAAGTACCAGAGGTCCAAGGGAGGAAAGTACCAGTTGCACTAGGGTCCCCCGCTTCAGTGAGAATCCACAGAATGATCTTCTAACAAGGAAGACAGGAAT

GCTGATGCAGTACCTGCTCTGCAAGTACAAAATGAAACAGCCAGCATCTAAGGGAGAAATGCTCAAAGTGATCAACAGAAGGTTCAAGGAGCAGTTGCCT

GAGATCCTCAAGAAAGCCTCTGAGCGCATTCAGCTAGTTTTTGGTCTTGAGGTGAAAGAAATTAAGCCCAATGGTGGCTACTACACCCTTGTTAGCAAGT

TAGATCCCAGTGTCGGTAATGCTCTGACCACTAGCCTGCCATTTCCCCAGAACGGGCTTTTGATGCCTCTTCTGGGTGTGATCTTCTTAAATGGCAACCG

TGCCTCTGAGGCAGAGATCTGGGAATTCCTTAATGTCTTGGGAATTTATGATGGGAAGGTGCACATAATCTTTGGGGAGCCCCGGAAGCTCATCACCAGA

GATCTGGTTAAGGAAAAGTACCTGGTATACCAAAAGGAGGCCAACAGTGATCCCCCATCCTTTGAGTTCCTTTGGGGTCCCCGAGCCTATGCTGAAACTA

CCAAGATGAAAATCCTGGAGTTTTTAGCCGAGGTCAATGAGACCGTTCCTCAGGCCTTCCCAACCCATTATGAGGAGGCTTTGAGAGATCAGGAAGAGAG

AGCCCAAGCCGAAGCTGTAGGCAGTCCTGGCACTAGTGCCAAAGATAAGGCAGAGGCTAAAGTCACACTGGTTGACTCCTCTTGCAAATATCAGGCTGAG

TCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGATCAGGCTGAGTCTAAAGTCACACTTGTTGACCCCTCTTGCAAAGATAATGCCAAGTCTAAGGTCA

CACTTGGCTCCTCTCGCAAATACAAGGCCAAGTCTAAAGTCCCACTGGTTGACTCCTCTTGCAAAGATCAGGCTGAGTCTAAAGTCACACTTGTGGACTC

TTGCAAAGATCAGGCTGAGTCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGATCAGGCTGAGTCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGAT

CAGGCTGAGTCTAAAGTCACACTTGTTGACCCCTCTTGCAAAGATAAGGCCAAGTCTAAGGTCACACTTGGCTCCTCTCACAAATACAAGGCCAAGTCTA

AAGTCACACTGGTTGACTCCTCTTGCAAAGATCAGGCTGAGTCTAAAGTCACACTAGTGGACTCTTCTTGTAAAGATCAGGCTGAGTCTAAAGTCACACT

TGTTGACCCCTCTTGCAAAGATAATGCCAAGTCTAAGGTCACACTTGGCTCCTCTCGCAAATACAAGGCCAAGTCTAAAGTCCCACTGGTTGACTCCTCT

GGAAAAGATAAGGCAGTCTAAAGTCGTACCTGACTCCTCTTGCTCCTGCAGAGATGAGAGGCAGATATGTCTTTAGGTTTAGAACAGGGTTTTTCACCTT

AAAAGTAGTGAGAGGTTGATAGTTCATAATACACATCTTATTGTGCTTTAGTTTATACCTTAGTCTTTTTAAGTGTTTCTCTTTTCTTAGAATCCTTATA

TAGGTTCAGGACTCACAGGTATAAATTACCTATATCAGTTATTGCTGTAAGATTTTAAGTATAAGAATTTTGGTATTCTGTATTACACTGTTAAAACCCT

GGAATCTTTAAGTTGATGAGCAAGCACCCATTACTTTGTAACGAAAGGAGCATTTCTTTGAAACATGTGAGAGAGTAATTTGTTTCTTAAGATAGACGAA

AACAAAGAGAAATGTGTAAACCGTCATTTTCCCTTATTCACTGTGTTTTTATTTCACTTTTTGGTAAAGTTTGAAGACATGTACTCAGTTGTTGTTAACT

GAATAAAATTGCAAAC
Translation
 - UNI35220 -  MPRGQKSKARAREKRRLVQDEAQELQDAQAKAGEKGKSPSCSNQDSGDAVASTSTAGFPQKSKSQGEAPTTTARKGGACRRSRKS

TRGPREESTSCTRVPRFSENPQNDLLTRKTGMLMQYLLCKYKMKQPASKGEMLKVINRRFKEQLPEILKKASERIQLVFGLEVKEIKPNGGYYTLVSKLD

PSVGNALTTSLPFPQNGLLMPLLGVIFLNGNRASEAEIWEFLNVLGIYDGKVHIIFGEPRKLITRDLVKEKYLVYQKEANSDPPSFEFLWGPRAYAETTK

MKILEFLAEVNETVPQAFPTHYEEALRDQEERAQAEAVGSPGTSAKDKAEAKVTLVDSSCKYQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTL

GSSRKYKAKSKVPLVDSSCKDQAESKVTLVDSCKDQAESKVTLVDSSCKDQAESKVTLVDSSCKDQAESKVTLVDPSCKDKAKSKVTLGSSHKYKAKSKV

TLVDSSCKDQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTLGSSRKYKAKSKVPLVDSSGKDKAV

For any suggestions or comments, please send an email to unitrap@crg.es