Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035435 (Abca17)
Chromosomal location
Chr 17: 24401204 - 24487974 (-)
Description
ATP-binding cassette, sub-family A (ABC1), member 17 Gene [Source:MGI (curated);Acc:Abca17-001]
RefSeq_dna
NM_001031621 
RefSeq_peptide
NP_001026792.2 
UniGene
Mm.328842 
MGI
MGI:3625331 
Uniprot/SPTREMBL
Q06RJ2 Q4H4D7 
Human Ortholog
not available
Omim not available
UniTrap UNI34817
Vector Insertion
Chr 17: 24484143 - 24487975
Public Clones IST14026C9 (tigm) IST13059B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33824
Vector Insertion
Chr 17: 24444390 - 24450266
Public Clones IST10230D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32992
Vector Insertion
Chr 17: 24437235 - 24444546
Public Clones IST14369E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115381
Sequence
GGTGAGTGAGGCGCAGCCCTCCCCGGATTCCGGGCTGCGGACCAGACCTGCCTAGCCTTAAG - UNI34817 - TGTTGAGCTTCTTCTTCAGCTGGG

AAAAGAAAAATGGAGGTGTTGAAGAAATTAAAACTCCTTCTCTGGAAGAATTTCATCTTAAAG - UNI34817 - AGGCGGAAGACTCTGATAACTCT

CCTGGAAATGTTGATGCCATTACTGTTTTGTGCAATTGTATTATATCTCCGTTTGAATAGTATGCCAAGAAAGAAGTCATCTACCAACTACCCGGCAGTT

GATGTCAGTTTACTGCCAGTATACTTCTATAACTATCCTCTGAAAAGTAAATTTCAGTTGGCTTATATCCCTTCCAAAAGTGAAACCTTAAAAGCTGTCA

CTGAAGTGGTGGAGCAAACCTTTGCTGTTGACTTTGAAG TTCTAGGCTTTCCTTCAGTGCCTTTATTTGAAGACTATATAATTAAGGATCCCAAGTCTT

TCTACATACTGGTGGGAATTATTTTTCACCATGACTTCAATAGCAGCAATGAACCTT
Translation
 - UNI34817 - MEVLKKLKLLLWKNFILK - UNI34817 - RRKTLITLLEMLMPLLFCAIVLYLRLNSMPRKKSSTNYPAVDVSLLPVYFYNYP

LKSKFQLAYIPSKSETLKAVTEVVEQTFAVDFEV VLGFPSVPLFEDYIIKDPKSFYILVGIIFHHDFNSSNEP
Transcript ENSMUST00000121226
Sequence
GGTGAGTGAGGCGCAGCCCTCCCCGGATTCCGGGCTGCGGACCAGACCTGCCTAGCCTTAAG - UNI34817 - TGTTGAGCTTCTTCTTCAGCTGGG

AAAAGAAAAATGGAGGTGTTGAAGAAATTAAAACTCCTTCTCTGGAAGAATTTCATCTTAAAG - UNI34817 - AGGCGGAAGACTCTGATAACTCT

CCTGGAAATGTTGATGCCATTACTGTTTTGTGCAATTGTATTATATCTCCGTTTGAATAGTATGCCAAGAAAGAAGTCATCTACCAACTACCCGGCAGTT

GATGTCAGTTTACTGCCAGTATACTTCTATAACTATCCTCTGAAAAGTAAATTTCAGTTGGCTTATATCCCTTCCAAAAGTGAAACCTTAAAAGCTGTCA

CTGAAGTGGTGGAGCAAACCTTTGCTGTTGACTTTGAAG TTCTAGGCTTTCCTTCAGTGCCTTTATTTGAAGACTATATAATTAAGGATCCCAAGTCTT

TCTACATACTGGTGGGAATTATTTTTCACCATGACTTCAATAGCAGCAATGAACCTTTGCCACTTGTG GTGAAGTATGACTTGCGCTTTAGTTATGTTC

AGAGGAACTTTGTATCACCGCCGAGGCATTTATTTTTTCAAGAGGAGATAGAAGGCTGGTGCACAGCCTTTCTTTACCCACCTAATCTAAGCCAAGCGCC

CCGGGAATTTTCATATGCGGATGGAGGAAACCCTG GCTACAACAAAGAAGGCTTCCTGGCCATACAGCATGCCGTAGACAAAGCGATTATGCGGCACCA

TGCCCCCAAAGCAGCACTTAACATGTTCAAGGATCTCCACGTCTTGGTGCAGAGATTCCCATTTGGGCCCCATATCCAGGACCCATTCTTAGTGATCCTT

CAGAATGAGTTCCCTCTGCTCCTCATGCTCAGCTTCATCTGTGTTGAGCTCATAATCACCAATTCCGTTTTGTCGGAGAAGGAGAGGAAACAGAAG GAA

TATATGAGTATGATGGGAGTGGAGAGCTGGCTGCACTGGGTTGCTTGGTTCATCACGTTTTTCATTTCTGTCTCAATTACTGTTTCTGTTATGACCGTAC

TTTTTTGCACAAAG ATAAACAGAGTGGCTGTGTTCAGGAACAGTAACCCTACCCTGATATTTATTTTTCTAATGTGTTTTGCCATCGCCACAATTTTCT

TTGCATTCATGATGAGCACATTCTTCCAAAGAG CCCACGTAGGAACTGTGATAGGTGGCACTGTCTTCTTCTTCACTTATCTTCCCTACATGTACATCA

CTTTCAGCTACCACCAGAGGACTTACACCCAGAAGATACTCTCTTGCCTCTTCTCCAATGTTGCCATGGCAACGGGAGTCCGGTTCATATCTCTGTTTGA

AGCAGAAG GCACAGGCATCCAATGGAGGAACATAGGCAGTGTCTGGGGAGACTTCAGCTTTGCTCAGGTGCTGGGGATGCTCTTGCTGGACTCCTTTTT

GTACTGTCTGATAGCCTTTTTGGTGGAGTCTCTCTTCCCAAGAAAGTTTGGAATACCTAAGTCTTGGTACATCTTTGCCAAG AAGCCCGTTCCAGAGAT

ACCGCCACTTTTGAATATTGGGGATCCTGAGAAACCGTCAAAAGGGAATTTCATGCAGGATGAGCCAACAAATCAGATGAACACAATTGAAATCCAACAT

CTGTATAAG - UNI33824 - GTGTTCTATTCGGGAAGGAGTAAACGTACAGCCATCAGAGATCTGAGCATGAACCTGTACAAGGGGCAGGTCACTGT

TCTTCTGGGACACAACGGAGCAGGGAAGACCACCGTCTGCTCTGTTCTGACAG - UNI32992 - - UNI33824 - GTCTCATTACTCCATCAAAA

GGACATGCATATATCCATGGATGTGAAATTTCAAAAGACATGGTTCAAATTAGGAAGAGCCTGGGCTGGTGCCCACAGCATGACATTTTATTTGATAACT

TTACAGTAACTGACCACCTTTATTTCTACGGTCAG - UNI32992 - - UNI33824 - CTGAAAGGTCTGTCTCCTCAGGACTGTCACGAGCAAAC

CCAGGAGATGCTGCATCTGCTTGGTCTGAAGGACAAGTGGAACTCAAGGTCCAAGTTCCTGAGTGGGGGCATGAAGCGCAAGCTCTCCATTGGCATCGCC

CTCATAGCGGGCTCTAAG - UNI32992 - GTGCTGATTTTGGATGAGCCCACCTCAGGCCTGGACTCCCCCTCCAGGAGGGCCATCTGGGACCTTCT

CCAGCAGCAGAAGGGTGACCGCACCGTCCTGCTGACCACTCACTTCATGGACGAAGCTGACCTGCTGGGAGACCGCATCGCCATCTTGGCCAAGGGGGAG

CTCCAGTGCTGCGGGTCACCATCGTTCCTCAAGCAGAAATACG GTGCAGGATACTATATGACTATAATAAAAACACCTCTCTGCGACACCTCAAAGCTC

TCTGAAGTAATTTATCACCACATACCGAATGCAGTTTTGGAGTCCAACATTGGAGAAGAAATGATAGTCACACTTCCTAAGAAGACCATACACAG GTTT

GAGGCTCTATTCAATGACTTGGAACTGAGACAGACAGAGCTGGGAATCTCTACTTTTGCCACCTCTGTAACCACTATGGAGGAAGTGTTCATACG AGTT

TGTAAGTTGGCTGATCCCAGCACAAATGTCTTAACCGAGAAGCGACACTCTCTTCATCCTCTTCCCCGGCATCACAGAGTTCCTGTTGACAGAATTAAAT

GTCTCCACTCAGGGACCTTCCCAGTGAGCACTGAACAGCCAATGAGACTAAATACGGGC TTCTGTCTTCTCTGCCAACAATTCTACGCCATGCTCTTGA

AAAAGATCACGTATTCTCGGCGCAACTGGATGCTGGTGCTCTCGGTGCAGGTTCTGCTGCCGCTGGCGATCATTATGTTAAGCCTCACCTTTTTTAACTT

CAAATTAAGGAAACTGGATAACGTGCCACTGGAGCTGACTTTACAAACGTACGGCCAGACCATTGTTCCATTTTTTATTGCCGAGAATTCTCACCTGGAC

CCTCAACTTTCAGATGACTTTGTAAAAATGCTTGTGGCCGCAGGGCAGGTTCCTTTGCGTATTCAAG GTTCTGTAGAGGACTTCCTCCTGAAGAAGGCA

AAGGAGGCTCCTGAGGGCTTTGATAAGCTCTACGTGGTGGCAGCTTCTTTTGAAGATGTGAATAACCACACGACAGTGAAGGCGCTGTTCAACAACCAGG

CCTACCACTCCCCTAGCCTGGCTCTGACTCTGGTGGACAATCTTCTCTTCAAGTTGCTTTCTGGAGCCAATGCTTCCATTACCACAACCAACTATCCTCA

GCCTCAGACAGCCATCGAGGTCTCAGAGTCAATCCTGTACCA GGGCCCTAAAGGACACTACCTTGTTGTCAACTTTCTTTTTGGAATAGCTTTCCTGTC

AAGCTCCTTCTCCATCTTGACAGTCGGAGAGAAGAGCGTTAAGTCTAAGAGCCTCCAGTTTGTGAGTGGAGTCAGCACGGCTGTGTTCTGGCTCTCAGCT

CTGCTGTGGGACCTCATCTCTTTCCTCGTTCCCACTCTGCTGCTGGTG TTGGTGTTTCTGTGGTATAAGGAAGAGGCTTTTGCACACCACGAGAGCATC

CCAGCGGTGGTCTTGATAATGATGCTCTACGGCTGGGCTGTCATCCCTTTGGTGTACACGGTCAGCTTCTCCTTTAACACTCCTGGCAGTGCATGTGTGA

AGCTCGTGGTGATGCTCACCTTCCTGAGCATCAGCCCTGTGGTCCTCGTCACCGTCACCAGTGAGAAAG ATCTTGGCTACACGGAACTCTCAGACTCCT

TGGATCATATTTTCCTAATTCTTCCTGGACATTGCCTGGGAATGGCCTTGTCCAACTTGTACTATAACTTTGAGCTGAAAAAGTTTTGCAGTGCTAAGAA

CTTGAGTGATATTGACTGCAATGATGTTT TAGAAGGATATGTGGTCCAAGAGAACATCTACGCCTGGGAATCTCTGGGGATAGGAAAGTACCTGACAGC

CCTGGCCGTCTTAGGACCTGTGTACATCACCATGCTTTTCCTCACTGAAGCCAATGCATTCTATGTACTGAAATCCAGGCTCTCTGGCTTCTTCCCTTCC

TTCTGGAAGGAAAAATCG GGAATGATCTTTGATGTAGCAGAACCTGAAGATGAAGATGTTCTGGAGGAGGCGGAAACCATCAAGCGTTATTTGGAAACG

TTAGTAAAGAAAAACCCGCTTGTTGTTAAAGAAGTGTCAAAG GTCTATAAAGACAAGGTACCCCTGTTGGCTGTGAACAAGGTGTCCTTTGTTGTTAAA

GAAGAAGAATGCTTTGGCCTTCTTGGTCTCAATGGAGCTGGGAAGACTTCCATTTTCAACATGCTGACCAGCGAGCAGCCCATCACCTCTGGGGATGCCT

TTGTCAAGGGTTTCAACATCAAGTCTGACATAGCGAAG GTGCGGCAGTGGATTGGTTACTGTCCTGAGTTTGATGCCTTGCTAAACTTCATGACAGGAC

GAGAGATGCTTGTCATGTATGCCCGTATCCGGGGCATCCCTGAATGCCACATTAAAGCCTGTGTCGACCTGATCCTTGAGAACTTACTCATGTGTGTGTG

TGCAGACAAGCTGGTGAAGACCTATAG TGGTGGTAACAAGCGCATGCTAAGCACTGGCATTGCCCTCGTTGGAGAGCCTGCAGTCATCCTGCTAGATGA

ACCGTCCACTGGCATGGACCCTGTGGCTCGGCGCCTGCTGTGGGACACTGTGGAACGGGTCCGTGAGTCTGGCAAGACCATCGTCATCACCTCCCACAG 

TATGGAGGAGTGTGAAGCCTTATGTACCAGGCTGGCCATCATGGTACAGGGCCAGTTCAAGTGCCTGGGCAGCCCACAGCACCTCAAGAGCAAATTTGGC

ATCAGCTACTCCCTGCAGGCCAAGGTCCGGAGGAAATGGCAGCAGCAGATGCTAGAGGAGTTCAAGGCCTTTGTGGACCTGACCTTCCCAG GCAGCAAT

TTGGAAGACGAGCACCAAAACATGCTTCAATATTACCTGCCTGGCCCAAACCTCAGCTGGGCGAAG GTGTTTAGCATTATGGAACAAGCCAAGAAGGAT

TACATGTTGGAAGACTACTCCATCAGCCAGCTATCCCTAGAGGACATCTTCCTGAACTTCACCAGACCAGAGTCCTCCACTAAAGAACAGATCCAACAAG

AGCAAGCTGTCCTGGCCAGCCCCTCACCACCCTCTAACTCTAGGCCTATCTCGAGTCCTCCATCACGTCTTTCTTCTCCGACTCCCAAACCACTTCCATC

CCCACCTCCCTCAGAGCCCATCCTTCTGTAATAAAGAGCTTAGTGTAGGGT
Translation
 - UNI34817 - MEVLKKLKLLLWKNFILK - UNI34817 - RRKTLITLLEMLMPLLFCAIVLYLRLNSMPRKKSSTNYPAVDVSLLPVYFYNYP

LKSKFQLAYIPSKSETLKAVTEVVEQTFAVDFEV VLGFPSVPLFEDYIIKDPKSFYILVGIIFHHDFNSSNEPLPLV VKYDLRFSYVQRNFVSPPRHL

FFQEEIEGWCTAFLYPPNLSQAPREFSYADGGNPG GYNKEGFLAIQHAVDKAIMRHHAPKAALNMFKDLHVLVQRFPFGPHIQDPFLVILQNEFPLLLM

LSFICVELIITNSVLSEKERKQK EYMSMMGVESWLHWVAWFITFFISVSITVSVMTVLFCTK INRVAVFRNSNPTLIFIFLMCFAIATIFFAFMMSTF

FQRA AHVGTVIGGTVFFFTYLPYMYITFSYHQRTYTQKILSCLFSNVAMATGVRFISLFEAEG GTGIQWRNIGSVWGDFSFAQVLGMLLLDSFLYCLI

AFLVESLFPRKFGIPKSWYIFAK KPVPEIPPLLNIGDPEKPSKGNFMQDEPTNQMNTIEIQHLYK - UNI33824 - VFYSGRSKRTAIRDLSMNLY

KGQVTVLLGHNGAGKTTVCSVLTG - UNI32992 - - UNI33824 - GLITPSKGHAYIHGCEISKDMVQIRKSLGWCPQHDILFDNFTVTDHLYF

YGQ - UNI32992 - - UNI33824 - LKGLSPQDCHEQTQEMLHLLGLKDKWNSRSKFLSGGMKRKLSIGIALIAGSK - UNI32992 - VLIL

DEPTSGLDSPSRRAIWDLLQQQKGDRTVLLTTHFMDEADLLGDRIAILAKGELQCCGSPSFLKQKYG GAGYYMTIIKTPLCDTSKLSEVIYHHIPNAVL

ESNIGEEMIVTLPKKTIHR RFEALFNDLELRQTELGISTFATSVTTMEEVFIR RVCKLADPSTNVLTEKRHSLHPLPRHHRVPVDRIKCLHSGTFPVS

TEQPMRLNTG FCLLCQQFYAMLLKKITYSRRNWMLVLSVQVLLPLAIIMLSLTFFNFKLRKLDNVPLELTLQTYGQTIVPFFIAENSHLDPQLSDDFVK

MLVAAGQVPLRIQG GSVEDFLLKKAKEAPEGFDKLYVVAASFEDVNNHTTVKALFNNQAYHSPSLALTLVDNLLFKLLSGANASITTTNYPQPQTAIEV

SESILYQ QGPKGHYLVVNFLFGIAFLSSSFSILTVGEKSVKSKSLQFVSGVSTAVFWLSALLWDLISFLVPTLLLV LVFLWYKEEAFAHHESIPAVVL

IMMLYGWAVIPLVYTVSFSFNTPGSACVKLVVMLTFLSISPVVLVTVTSEKD DLGYTELSDSLDHIFLILPGHCLGMALSNLYYNFELKKFCSAKNLSD

IDCNDVL LEGYVVQENIYAWESLGIGKYLTALAVLGPVYITMLFLTEANAFYVLKSRLSGFFPSFWKEKS GMIFDVAEPEDEDVLEEAETIKRYLETL

VKKNPLVVKEVSK VYKDKVPLLAVNKVSFVVKEEECFGLLGLNGAGKTSIFNMLTSEQPITSGDAFVKGFNIKSDIAK VRQWIGYCPEFDALLNFMTG

REMLVMYARIRGIPECHIKACVDLILENLLMCVCADKLVKTYS SGGNKRMLSTGIALVGEPAVILLDEPSTGMDPVARRLLWDTVERVRESGKTIVITS

HS SMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGISYSLQAKVRRKWQQQMLEEFKAFVDLTFPG GSNLEDEHQNMLQYYLPGPNLSWAK VFSIM

EQAKKDYMLEDYSISQLSLEDIFLNFTRPESSTKEQIQQEQAVLASPSPPSNSRPISSPPSRLSSPTPKPLPSPPPSEPILL
Transcript ENSMUST00000039324
Sequence
ATGGAGGTGTTGAAGAAATTAAAACTCCTTCTCTGGAAGAATTTCATCTTAAAG - UNI34817 - AGGCGGAAGACTCTGATAACTCTCCTGGAAAT

GTTGATGCCATTACTGTTTTGTGCAATTGTATTATATCTCCGTTTGAATAGTATGCCAAGAAAGAAGTCATCTACCAACTACCCGGCAGTTGATGTCAGT

TTACTGCCAGTATACTTCTATAACTATCCTCTGAAAAGTAAATTTCAGTTGGCTTATATCCCTTCCAAAAGTGAAACCTTAAAAGCTGTCACTGAAGTGG

TGGAGCAAACCTTTGCTGTTGACTTTGAAG TTCTAGGCTTTCCTTCAGTGCCTTTATTTGAAGACTATATAATTAAGGATCCCAAGTCTTTCTACATAC

TGGTGGGAATTATTTTTCACCATGACTTCAATAGCAGCAATGAACCTTTGCCACTTGTG GTGAAGTATGACTTGCGCTTTAGTTATGTTCAGAGGAACT

TTGTATCACCGCCGAGGCATTTATTTTTTCAAGAGGAGATAGAAGGCTGGTGCACAGCCTTTCTTTACCCACCTAATCTAAGCCAAGCGCCCCGGGAATT

TTCATATGCGGATGGAGGAAACCCTG GCTACAACAAAGAAGGCTTCCTGGCCATACAGCATGCCGTAGACAAAGCGATTATGCGGCACCATGCCCCCAA

AGCAGCACTTAACATGTTCAAGGATCTCCACGTCTTGGTGCAGAGATTCCCATTTGGGCCCCATATCCAGGACCCATTCTTAGTGATCCTTCAGAATGAG

TTCCCTCTGCTCCTCATGCTCAGCTTCATCTGTGTTGAGCTCATAATCACCAATTCCGTTTTGTCGGAGAAGGAGAGGAAACAGAAG GAATATATGAGT

ATGATGGGAGTGGAGAGCTGGCTGCACTGGGTTGCTTGGTTCATCACGTTTTTCATTTCTGTCTCAATTACTGTTTCTGTTATGACCGTACTTTTTTGCA

CAAAG ATAAACAGAGTGGCTGTGTTCAGGAACAGTAACCCTACCCTGATATTTATTTTTCTAATGTGTTTTGCCATCGCCACAATTTTCTTTGCATTCA

TGATGAGCACATTCTTCCAAAGAG CCCACGTAGGAACTGTGATAGGTGGCACTGTCTTCTTCTTCACTTATCTTCCCTACATGTACATCACTTTCAGCT

ACCACCAGAGGACTTACACCCAGAAGATACTCTCTTGCCTCTTCTCCAATGTTGCCATGGCAACGGGAGTCCGGTTCATATCTCTGTTTGAAGCAGAAG 

GCACAGGCATCCAATGGAGGAACATAGGCAGTGTCTGGGGAGACTTCAGCTTTGCTCAGGTGCTGGGGATGCTCTTGCTGGACTCCTTTTTGTACTGTCT

GATAGCCTTTTTGGTGGAGTCTCTCTTCCCAAGAAAGTTTGGAATACCTAAGTCTTGGTACATCTTTGCCAAG AAGCCCGTTCCAGAGATACCGCCACT

TTTGAATATTGGGGATCCTGAGAAACCGTCAAAAGGGAATTTCATGCAGGATGAGCCAACAAATCAGATGAACACAATTGAAATCCAACATCTGTATAAG

 - UNI33824 - GTGTTCTATTCGGGAAGGAGTAAACGTACAGCCATCAGAGATCTGAGCATGAACCTGTACAAGGGGCAGGTCACTGTTCTTCTGGG

ACACAACGGAGCAGGGAAGACCACCGTCTGCTCTGTTCTGACAG - UNI32992 - - UNI33824 - GTCTCATTACTCCATCAAAAGGACATGCA

TATATCCATGGATGTGAAATTTCAAAAGACATGGTTCAAATTAGGAAGAGCCTGGGCTGGTGCCCACAGCATGACATTTTATTTGATAACTTTACAGTAA

CTGACCACCTTTATTTCTACGGTCAG - UNI32992 - - UNI33824 - CTGAAAGGTCTGTCTCCTCAGGACTGTCACGAGCAAACCCAGGAGAT

GCTGCATCTGCTTGGTCTGAAGGACAAGTGGAACTCAAGGTCCAAGTTCCTGAGTGGGGGCATGAAGCGCAAGCTCTCCATTGGCATCGCCCTCATAGCG

GGCTCTAAG - UNI32992 - GTGCTGATTTTGGATGAGCCCACCTCAGGCCTGGACTCCCCCTCCAGGAGGGCCATCTGGGACCTTCTCCAGCAGCA

GAAGGGTGACCGCACCGTCCTGCTGACCACTCACTTCATGGACGAAGCTGACCTGCTGGGAGACCGCATCGCCATCTTGGCCAAGGGGGAGCTCCAGTGC

TGCGGGTCACCATCGTTCCTCAAGCAGAAATACG GTGCAGGATACTATATGACTATAATAAAAACACCTCTCTGCGACACCTCAAAGCTCTCTGAAGTA

ATTTATCACCACATACCGAATGCAGTTTTGGAGTCCAACATTGGAGAAGAAATGATAGTCACACTTCCTAAGAAGACCATACACAG GTTTGAGGCTCTA

TTCAATGACTTGGAACTGAGACAGACAGAGCTGGGAATCTCTACTTTTGCCACCTCTGTAACCACTATGGAGGAAGTGTTCATACG AGTTTGTAAGTTG

GCTGATCCCAGCACAAATGTCTTAACCGAGAAGCGACACTCTCTTCATCCTCTTCCCCGGCATCACAGAGTTCCTGTTGACAGAATTAAATGTCTCCACT

CAGGGACCTTCCCAGTGAGCACTGAACAGCCAATGAGACTAAATACGGGC TTCTGTCTTCTCTGCCAACAATTCTACGCCATGCTCTTGAAAAAGATCA

CGTATTCTCGGCGCAACTGGATGCTGGTGCTCTCGGTGCAGGTTCTGCTGCCGCTGGCGATCATTATGTTAAGCCTCACCTTTTTTAACTTCAAATTAAG

GAAACTGGATAACGTGCCACTGGAGCTGACTTTACAAACGTACGGCCAGACCATTGTTCCATTTTTTATTGCCGAGAATTCTCACCTGGACCCTCAACTT

TCAGATGACTTTGTAAAAATGCTTGTGGCCGCAGGGCAGGTTCCTTTGCGTATTCAAG GTTCTGTAGAGGACTTCCTCCTGAAGAAGGCAAAGGAGGCT

CCTGAGGGCTTTGATAAGCTCTACGTGGTGGCAGCTTCTTTTGAAGATGTGAATAACCACACGACAGTGAAGGCGCTGTTCAACAACCAGGCCTACCACT

CCCCTAGCCTGGCTCTGACTCTGGTGGACAATCTTCTCTTCAAGTTGCTTTCTGGAGCCAATGCTTCCATTACCACAACCAACTATCCTCAGCCTCAGAC

AGCCATCGAGGTCTCAGAGTCAATCCTGTACCA GGGCCCTAAAGGACACTACCTTGTTGTCAACTTTCTTTTTGGAATAGCTTTCCTGTCAAGCTCCTT

CTCCATCTTGACAGTCGGAGAGAAGAGCGTTAAGTCTAAGAGCCTCCAGTTTGTGAGTGGAGTCAGCACGGCTGTGTTCTGGCTCTCAGCTCTGCTGTGG

GACCTCATCTCTTTCCTCGTTCCCACTCTGCTGCTGGTG TTGGTGTTTCTGTGGTATAAGGAAGAGGCTTTTGCACACCACGAGAGCATCCCAGCGGTG

GTCTTGATAATGATGCTCTACGGCTGGGCTGTCATCCCTTTGGTGTACACGGTCAGCTTCTCCTTTAACACTCCTGGCAGTGCATGTGTGAAGCTCGTGG

TGATGCTCACCTTCCTGAGCATCAGCCCTGTGGTCCTCGTCACCGTCACCAGTGAGAAAG ATCTTGGCTACACGGAACTCTCAGACTCCTTGGATCATA

TTTTCCTAATTCTTCCTGGACATTGCCTGGGAATGGCCTTGTCCAACTTGTACTATAACTTTGAGCTGAAAAAGTTTTGCAGTGCTAAGAACTTGAGTGA

TATTGACTGCAATGATGTTT TAGAAGGATATGTGGTCCAAGAGAACATCTACGCCTGGGAATCTCTGGGGATAGGAAAGTACCTGACAGCCCTGGCCGT

CTTAGGACCTGTGTACATCACCATGCTTTTCCTCACTGAAGCCAATGCATTCTATGTACTGAAATCCAGGCTCTCTGGCTTCTTCCCTTCCTTCTGGAAG

GAAAAATCG GGAATGATCTTTGATGTAGCAGAACCTGAAGATGAAGATGTTCTGGAGGAGGCGGAAACCATCAAGCGTTATTTGGAAACGTTAGTAAAG

AAAAACCCGCTTGTTGTTAAAGAAGTGTCAAAG GTCTATAAAGACAAGGTACCCCTGTTGGCTGTGAACAAGGTGTCCTTTGTTGTTAAAGAAGAAGAA

TGCTTTGGCCTTCTTGGTCTCAATGGAGCTGGGAAGACTTCCATTTTCAACATGCTGACCAGCGAGCAGCCCATCACCTCTGGGGATGCCTTTGTCAAGG

GTTTCAACATCAAGTCTGACATAGCGAAG GTGCGGCAGTGGATTGGTTACTGTCCTGAGTTTGATGCCTTGCTAAACTTCATGACAGGACGAGAGATGC

TTGTCATGTATGCCCGTATCCGGGGCATCCCTGAATGCCACATTAAAGCCTGTGTCGACCTGATCCTTGAGAACTTACTCATGTGTGTGTGTGCAGACAA

GCTGGTGAAGACCTATAG TGGTGGTAACAAGCGCATGCTAAGCACTGGCATTGCCCTCGTTGGAGAGCCTGCAGTCATCCTGCTAGATGAACCGTCCAC

TGGCATGGACCCTGTGGCTCGGCGCCTGCTGTGGGACACTGTGGAACGGGTCCGTGAGTCTGGCAAGACCATCGTCATCACCTCCCACAG TATGGAGGA

GTGTGAAGCCTTATGTACCAGGCTGGCCATCATGGTACAGGGCCAGTTCAAGTGCCTGGGCAGCCCACAGCACCTCAAGAGCAAATTTGGCATCAGCTAC

TCCCTGCAGGCCAAGGTCCGGAGGAAATGGCAGCAGCAGATGCTAGAGGAGTTCAAGGCCTTTGTGGACCTGACCTTCCCAG GCAGCAATTTGGAAGAC

GAGCACCAAAACATGCTTCAATATTACCTGCCTGGCCCAAACCTCAGCTGGGCGAAG GTGTTTAGCATTATGGAACAAGCCAAGAAGGATTACATGTTG

GAAGACTACTCCATCAGCCAGCTATCCCTAGAGGACATCTTCCTGAACTTCACCAGACCAGAGTCCTCCACTAAAGAACAGATCCAACAAGAGCAAGCTG

TCCTGGCCAGCCCCTCACCACCCTCTAACTCTAGGCCTATCTCGAGTCCTCCATCACGTCTTTCTTCTCCGACTCCCAAACCACTTCCATCCCCACCTCC

CTCAGAGCCCATCCTTCTGTAA
Translation
MEVLKKLKLLLWKNFILK - UNI34817 - RRKTLITLLEMLMPLLFCAIVLYLRLNSMPRKKSSTNYPAVDVSLLPVYFYNYPLKSKFQLAYIPSKS

ETLKAVTEVVEQTFAVDFEV VLGFPSVPLFEDYIIKDPKSFYILVGIIFHHDFNSSNEPLPLV VKYDLRFSYVQRNFVSPPRHLFFQEEIEGWCTAFL

YPPNLSQAPREFSYADGGNPG GYNKEGFLAIQHAVDKAIMRHHAPKAALNMFKDLHVLVQRFPFGPHIQDPFLVILQNEFPLLLMLSFICVELIITNSV

LSEKERKQK EYMSMMGVESWLHWVAWFITFFISVSITVSVMTVLFCTK INRVAVFRNSNPTLIFIFLMCFAIATIFFAFMMSTFFQRA AHVGTVIGG

TVFFFTYLPYMYITFSYHQRTYTQKILSCLFSNVAMATGVRFISLFEAEG GTGIQWRNIGSVWGDFSFAQVLGMLLLDSFLYCLIAFLVESLFPRKFGI

PKSWYIFAK KPVPEIPPLLNIGDPEKPSKGNFMQDEPTNQMNTIEIQHLYK - UNI33824 - VFYSGRSKRTAIRDLSMNLYKGQVTVLLGHNGAG

KTTVCSVLTG - UNI32992 - - UNI33824 - GLITPSKGHAYIHGCEISKDMVQIRKSLGWCPQHDILFDNFTVTDHLYFYGQ - UNI32992

 - - UNI33824 - LKGLSPQDCHEQTQEMLHLLGLKDKWNSRSKFLSGGMKRKLSIGIALIAGSK - UNI32992 - VLILDEPTSGLDSPSRRA

IWDLLQQQKGDRTVLLTTHFMDEADLLGDRIAILAKGELQCCGSPSFLKQKYG GAGYYMTIIKTPLCDTSKLSEVIYHHIPNAVLESNIGEEMIVTLPK

KTIHR RFEALFNDLELRQTELGISTFATSVTTMEEVFIR RVCKLADPSTNVLTEKRHSLHPLPRHHRVPVDRIKCLHSGTFPVSTEQPMRLNTG FCL

LCQQFYAMLLKKITYSRRNWMLVLSVQVLLPLAIIMLSLTFFNFKLRKLDNVPLELTLQTYGQTIVPFFIAENSHLDPQLSDDFVKMLVAAGQVPLRIQG

 GSVEDFLLKKAKEAPEGFDKLYVVAASFEDVNNHTTVKALFNNQAYHSPSLALTLVDNLLFKLLSGANASITTTNYPQPQTAIEVSESILYQ QGPKGH

YLVVNFLFGIAFLSSSFSILTVGEKSVKSKSLQFVSGVSTAVFWLSALLWDLISFLVPTLLLV LVFLWYKEEAFAHHESIPAVVLIMMLYGWAVIPLVY

TVSFSFNTPGSACVKLVVMLTFLSISPVVLVTVTSEKD DLGYTELSDSLDHIFLILPGHCLGMALSNLYYNFELKKFCSAKNLSDIDCNDVL LEGYVV

QENIYAWESLGIGKYLTALAVLGPVYITMLFLTEANAFYVLKSRLSGFFPSFWKEKS GMIFDVAEPEDEDVLEEAETIKRYLETLVKKNPLVVKEVSK 

VYKDKVPLLAVNKVSFVVKEEECFGLLGLNGAGKTSIFNMLTSEQPITSGDAFVKGFNIKSDIAK VRQWIGYCPEFDALLNFMTGREMLVMYARIRGIP

ECHIKACVDLILENLLMCVCADKLVKTYS SGGNKRMLSTGIALVGEPAVILLDEPSTGMDPVARRLLWDTVERVRESGKTIVITSHS SMEECEALCTR

LAIMVQGQFKCLGSPQHLKSKFGISYSLQAKVRRKWQQQMLEEFKAFVDLTFPG GSNLEDEHQNMLQYYLPGPNLSWAK VFSIMEQAKKDYMLEDYSI

SQLSLEDIFLNFTRPESSTKEQIQQEQAVLASPSPPSNSRPISSPPSRLSSPTPKPLPSPPPSEPILL

For any suggestions or comments, please send an email to unitrap@crg.es