Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035437 (Rabgap1)
Chromosomal location
Chr 2: 37298805 - 37421974 (+)
Description
RAB GTPase activating protein 1 Gene [Source:MGI (curated);Acc:Rabgap1-004]
RefSeq_dna
NM_001033960 NM_146121 
RefSeq_peptide
NP_001029132.1 NP_666233.2 
UniGene
Mm.438200 Mm.383192 
MGI
MGI:2385139 
Uniprot/SWISSPROT
A2AWA9 
Uniprot/SPTREMBL
A2AWA7 A2AWB0 B2RRC5 
Human Ortholog
ENSG00000011454 (RABGAP1)
Omim not available
UniTrap UNI10402
Vector Insertion
Chr 2: 37298977 - 37307773
Public Clones D073A04 (ggtc) P140C01 (ggtc) PST1588-1 (escells) IST14148B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30720
Vector Insertion
Chr 2: 37307822 - 37324896
Public Clones IST10083H1BBR1 (tigm) IST10083G1BBR1 (tigm) IST10083H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17202
Vector Insertion
Chr 2: 37324896 - 37325097
Public Clones not available
Private Clones OST447621 (lexicon) OST441313 (lexicon) OST246637 (lexicon) OST79652 (lexicon)
OST63734 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4097
Vector Insertion
Chr 2: 37330987 - 37339247
Public Clones AN0762 (sanger) XK151 (baygenomics)
Private Clones OST360974 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5530
Vector Insertion
Chr 2: 37351278 - 37358387
Public Clones YTA112 (baygenomics) CSI468 (baygenomics) CSH320 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3897
Vector Insertion
Chr 2: 37364599 - 37388035
Public Clones AW0078 (sanger) RRM217 (baygenomics) RRJ627 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20814
Vector Insertion
Chr 2: 37392897 - 37395936
Public Clones not available
Private Clones OST351472 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066055
Sequence
GGGAGGCCCAGGCGGCGGAGCCTCCCTGACGGCGCTCGGCGGCAGCAG - UNI17202 - - UNI30720 - GCATTAAAAAAATATTTAACCATTC

ATGAGTTGAGCCTCATTCTTGAGTTATGGATGACAAGGCCTCTGTTGGAAAAATCAGTGTCTCATCAGACTCAGTGTCTACTCTTAATAGTGAAGATTTT

GTCTTGGTTTCCAGGCAAGGAGATGAGACACCATCTACAAATAATGGGAGTGATGATGAGAAGACGGGACTCAAG - UNI17202 - ATTGTAGGAAA

TGGAAGTGAGCAGCAGCTTCAGAAAGAGCTAGCAGATGTGCTGATGGATCCTCCCATGGACGACCAGCCAGGGGAAAGGTCACAACTGGATGGTGAAGGA

GATGGGCCTCTTTCTAATCAACTCTCAGCTTCATCCACCATTAATCCTGTGCCTCTGGTAGGGCTTCCGAAACCAGAGATGAGCCTGCCAGTGAAACCTG

GACAAGGAG ATTCTGAAGTATCAAGTCCTTTTACACCAGTGGCTGATGAGGATAGTGTGGTTTTCAATAAACTAACTTACTTAGGCTGTGCTTCAGTAA

ATGCTCCCCGGAGTGAAGTGGAAGCCTTGAGGATGATGTCCATCTTGAGAAGTCAGTGTCAGATTTCTCTGGATGTAACCCTCTCAGTGCCGAATGTATC

TGAAGGAACTGTGAG ACTTTTAGATCCTCAAACAAACACTGAAATAGCAAACTACCCTATCTACAAAATCCTCTTCTGTGTCAGAGGACATGATGGGAC

TCCTGAGAGTGACTGTTTTGCATTCACTGAAAGTCACTACAACGCAGAGCTCTTCAGGATACATGTCTTTCGCTGTGAAATACAAGAAGCT - UNI409

7 - GTGAGCCGGATACTTTACAGTTTTGCCACCGCCTTCCGCCGCTCTGCCAAGCAGACCCCACTCTCAGCCACAGCTGCACCACAGACTCCTGACAGC

GACATCTTTACCTTCTCTGTGTCTTTAGAAATAAAAGAAGATGATGGTAAAGGTTATTTTAG TGCTGTTCCCAAAGACAAGGACAGGCAATGCTTTAAA

CTTCGACAAGGAATTGATAAGAAGATTGTTATCTGTGTGCAGCAAACAGCTAACAAAGAACTTGCCATTGAAAG GTGCTTTGGTCTTCTCCTTAGCCCA

GGAAAAGATGTCCGAAACAGTGATATGCACTTGCTGGATTTG GAGTCTATGGGCAAAAGTTCAGATGGAAAATCATATGTTATTACTGGAAGCTGGAAC

CCGAAATCCCCACATTTTCAAGTTGTGAATGAAGAAACTCCTAAAG ATAAAGTGCTGTTCATGACAACAGCTGTGGATTTGGTGATAACTGAAGTACAG

GAACCTGTTCGATTTCTTCTAGAGACAAAAGTTCGAGTGTGCTCACCTAATGAAAGGTTATTCTGGCCCTTCAGCAAACGAAGCACTACTGAAAACTTCT

TTCTGAAACTGAAGCAG ATAAAGCAAAAGGAGAAAAAGAATAATGCTGACACTTTATATGAAGTTGTGTGTTTGGAGAGTGAGTCAGAGAGAGAGAGGA

GGAAAACCACAGCCAGTCCTTCAGTTCGCCTGCCACAGTCTGGATCCCAGAGCTCCATGATCCCCTCTCCCCCAGAAGATGATGAAGAAGAAG - UNI5

530 - ATAATGATGAACCTCTCTTGAGTGGATTTGGGGATGTATCCAAAGAATGTGCAGAAAAAATTCTTGAAACATGGGGAGAACTGCTGTCAAAATG

 GCATCTCAACTTGAGTGTGAGACCGAAGCAGTTGTCATCCTTAGTGAGAAGTGGTGTTCCTGAAGCTCTTCGTGGAGAAGTCTGGCAGCTGCTAGCAGG

CTGCCACAACAACGATCACTTAGTAGAAAAGTACCGAATTCTCATCACAAAG - UNI3897 - GAGTCTCCTCAAGACAGTGCTATCACCAGAGATAT

TAACCGCACATTTCCAGCTCATGACTACTTCAAGGACACAGGAGGAGATGGACAAGATTCTTTATATAAAATATGCAAG GCATATTCTGTGTATGATGA

AGAGATTGGTTACTGCCAGGGCCAGTCCTTCCTCGCAGCTGTACTGCTTCTCCAC - UNI20814 - ATGCCCGAAGAACAGGCATTCAGTGTTCTGG

TCAAGATCATGTTTGACTATGGTCTCAGGGAACTTTTCAAACAAAATTTTGAAGATCTTCATTGCAAGTTCTACCAGTTGGAGCGCCTTATGCAG GAAT

ACATTCCTGACCTGTACAACCACTTCCTGGATATCAGCCTTGAAGCACACATGTACGCCTCCCAGTGGTTCCTTACACTTTTCACTGCAAAATTCCCTCT

CTACATGGTCTTCCATATCATCGACCTGCTCTTATGTGAG GGAATAAGTGTCATCTTTAATGTCGCCCTTGGATTACTAAAG ACTTCCAAGGATGACT

TGCTGTTGACAGACTTTGAGGGTGCCTTGAAGTTCTTCAGGGTTCAGCTCCCTAAAAGATACCGCTCAGAAGAAAATGCAAAGAGGCTCATGGAGCTTGC

CTGTAACACAAAGGTACAGCAACGTTTGCTCTAACTTAGTCTTCCTTTTTCAGTTGATGCCTCAGATTTTCTGATAAAATTGTTAATGCTTATAATATAT

AATTGATATTTCACATCAAGTGCCCCTTTTTGTAAATGGTTGCTGCCAGAGTATATTGGAAACTATTGGAAGCTCTTTGTTGTATTTGTTGTTTTGGTGG

GAGTAGTGTTGTTGCTTTTTATATTTTTACTGCACAATCTTGGGGTTAGAACTCAAGTGTATTACTTTCCGAATTCATGTGTATTTCATATATAGCTCAT

ATATACAGGATAATTTCAGGATATTGTTGTATAAGACTTGGTGTTTTGGCTGTGGTGTCTCATGGAGTCAGGTGTAACGTCATGTCAGTAATAAAAAACA

AAATCATATTTACTTAGCTTGGTGATATACACTGTAGTATCAGCACTTGGGAGGCCAAAAGGCAAGAGAATCATTAGTTTCAGGCTTGCCTGGGCTACAT

ATGAGCACCAAGCAAACCTGATCCACATAGCAACTCTAACTCACAAAACCAAAATAAACAAAATGGTGACAATTCTGAGAACATGCAGTATCTCCCATTA

TCAGATTATGGAATTATATCCCATAATAAGTATGTTGTGTTGTATACCTTTGTACCTTTCTGGTTTCAAAACACCTTCATATATACTTTGACTTTTTTGT

ATCTGTGCATTTCCTGTTTATGGGTTCAATCAATTGTGAATTGAAGATATTTGGAGAAAAATACACATGTGCATTTTTTTTCTTCATTGTCAATATTCCC

TAAATATTTTATCTGGGTATTTATTACCAACCAGTCTAGAGGTTGTCTCTGTGAGGTAGTATGCACACAGGTTCTACACAAATACTTCATGACATAATAT

AAGGAACTGCGCATGCTCTGATTTCAGTATCTAAGGGCTTCGTAGACCCAGCTGTCTGTGAACCCTTAGGGGTGACTGTATCTTAACATTTTTGAGTTGT

TGAACCTCATTGGCCCTTACCATCTACGCTATAGAAAGAGTGTTACTGTCCAGTTTAAAGACAGACTGAAACAGAAGCTCTTTAGACTTTGACCTGGTCA

AGGACAGAATTTCATTTTCTTGATTTCCACTCTACTGTCTTCACCCTTTGACACATTTATTGTGATCAGAAATTCTCTAAAAAGAACTAAAATATGGAGA

AGCCTCATAATCTTATAATTTCACATGGCTTTATCATTTTTACAGGTTTTTTATGGTCAAAAAATAAATGATCCCAATGTACTAATGTTCTTATAAGTTT

GTATTTTCAAAGAGAAAATACATTCAAGATGCTTTAATTAGGAATTCAAGGTAGAGACAGTGTCAGAACAAAGATTGTATTTAGGCTCATATAAAGTACA

GTGCAGAGTTTCATGTTGCCCTGTGCTAAGTTCTGTGTCACTGTAGAGCAGACACTGGACTGACTAGAGGATGCAGCTAGGGTTTGGAATGGCCTTCTTG

TCTCTTAAAGGAATGATAAAATAATTCCTATTAGCATAAGAAAAGTAATATTCTCTGAGAGATTGTTCACAACATGCCAGATGCCCTGGCTAAGTGTTTC

TATATGTGGGTTAACCATGATAGTATGTACATTGATTAATATACTGCCTAACAATTATTAAATGTTCATGAAATGATTGCTACTGCTAGGATTTGCTTAT

CTCTGTTTCTTCAATCAGATAAATAAATAAATAAATAAATAAAT
Translation
 - UNI17202 - - UNI30720 - MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLK - UNI17202 - IVGNGSEQQ

LQKELADVLMDPPMDDQPGERSQLDGEGDGPLSNQLSASSTINPVPLVGLPKPEMSLPVKPGQGD DSEVSSPFTPVADEDSVVFNKLTYLGCASVNAPR

SEVEALRMMSILRSQCQISLDVTLSVPNVSEGTVR RLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHVFRCEIQEA - UN

I4097 - VSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKEDDGKGYFS SAVPKDKDRQCFKLRQGIDKKIVICVQQTANKELAIER

 RCFGLLLSPGKDVRNSDMHLLDL ESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKD DKVLFMTTAVDLVITEVQEPVRFLLETKVRVCSPNERLF

WPFSKRSTTENFFLKLKQ IKQKEKKNNADTLYEVVCLESESERERRKTTASPSVRLPQSGSQSSMIPSPPEDDEEED - UNI5530 - DNDEPLLSG

FGDVSKECAEKILETWGELLSKW WHLNLSVRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITK - UNI3897 - ESPQDSAITRDI

NRTFPAHDYFKDTGGDGQDSLYKICK AYSVYDEEIGYCQGQSFLAAVLLLH - UNI20814 - MPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKF

YQLERLMQ EYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCE GISVIFNVALGLLK TSKDDLLLTDFEGALKFFRVQLPKRYR

SEENAKRLMELACNTKVQQRLL
Transcript ENSMUST00000112919
Sequence
GGGGCGAGGCCAGGGAATCGGGCTGCGGAGGGTCGGCTTCGTGAGCTCTGCTGCTTGTGGTTCTTCGGTAGAAGGCGGGCCCGAGCTCTCTTCTTCGCGG

CTGCAGTCACGAAGTGCTCCCGCTGACCGTTGCCTGCATGGGCCTGAGCAGCCTGTCTGCGAACAAGCCGTG - UNI10402 - - UNI17202 - -

 UNI30720 - GCATTAAAAAAATATTTAACCATTCATGAGTTGAGCCTCATTCTTGAGTTATGGATGACAAGGCCTCTGTTGGAAAAATCAGTGTCTC

ATCAGACTCAGTGTCTACTCTTAATAGTGAAGATTTTGTCTTGGTTTCCAGGCAAGGAGATGAGACACCATCTACAAATAATGGGAGTGATGATGAGAAG

ACGGGACTCAAG - UNI17202 - ATTGTAGGAAATGGAAGTGAGCAGCAGCTTCAGAAAGAGCTAGCAGATGTGCTGATGGATCCTCCCATGGACGA

CCAGCCAGGGGAAAGGTCACAACTGGATGGTGAAGGAGATGGGCCTCTTTCTAATCAACTCTCAGCTTCATCCACCATTAATCCTGTGCCTCTGGTAGGG

CTTCCGAAACCAGAGATGAGCCTGCCAGTGAAACCTGGACAAGGAG ATTCTGAAGTATCAAGTCCTTTTACACCAGTGGCTGATGAGGATAGTGTGGTT

TTCAATAAACTAACTTACTTAGGCTGTGCTTCAGTAAATGCTCCCCGGAGTGAAGTGGAAGCCTTGAGGATGATGTCCATCTTGAGAAGTCAGTGTCAGA

TTTCTCTGGATGTAACCCTCTCAGTGCCGAATGTATCTGAAGGAACTGTGAG ACTTTTAGATCCTCAAACAAACACTGAAATAGCAAACTACCCTATCT

ACAAAATCCTCTTCTGTGTCAGAGGACATGATGGGACTCCTGAGAGTGACTGTTTTGCATTCACTGAAAGTCACTACAACGCAGAGCTCTTCAGGATACA

TGTCTTTCGCTGTGAAATACAAGAAGCT - UNI4097 - GTGAGCCGGATACTTTACAGTTTTGCCACCGCCTTCCGCCGCTCTGCCAAGCAGACCCC

ACTCTCAGCCACAGCTGCACCACAGACTCCTGACAGCGACATCTTTACCTTCTCTGTGTCTTTAGAAATAAAAGAAGATGATGGTAAAGGTTATTTTAG 

TGCTGTTCCCAAAGACAAGGACAGGCAATGCTTTAAACTTCGACAAGGAATTGATAAGAAGATTGTTATCTGTGTGCAGCAAACAGCTAACAAAGAACTT

GCCATTGAAAG GTGCTTTGGTCTTCTCCTTAGCCCAGGAAAAGATGTCCGAAACAGTGATATGCACTTGCTGGATTTG GAGTCTATGGGCAAAAGTTC

AGATGGAAAATCATATGTTATTACTGGAAGCTGGAACCCGAAATCCCCACATTTTCAAGTTGTGAATGAAGAAACTCCTAAAG ATAAAGTGCTGTTCAT

GACAACAGCTGTGGATTTGGTGATAACTGAAGTACAGGAACCTGTTCGATTTCTTCTAGAGACAAAAGTTCGAGTGTGCTCACCTAATGAAAGGTTATTC

TGGCCCTTCAGCAAACGAAGCACTACTGAAAACTTCTTTCTGAAACTGAAGCAG ATAAAGCAAAAGGAGAAAAAGAATAATGCTGACACTTTATATGAA

GTTGTGTGTTTGGAGAGTGAGTCAGAGAGAGAGAGGAGGAAAACCACAGCCAGTCCTTCAGTTCGCCTGCCACAGTCTGGATCCCAGAGCTCCATGATCC

CCTCTCCCCCAGAAGATGATGAAGAAGAAG - UNI5530 - ATAATGATGAACCTCTCTTGAGTGGATTTGGGGATGTATCCAAAGAATGTGCAGAAA

AAATTCTTGAAACATGGGGAGAACTGCTGTCAAAATG GCATCTCAACTTGAGTGTGAGACCGAAGCAGTTGTCATCCTTAGTGAGAAGTGGTGTTCCTG

AAGCTCTTCGTGGAGAAGTCTGGCAGCTGCTAGCAGGCTGCCACAACAACGATCACTTAGTAGAAAAGTACCGAATTCTCATCACAAAG - UNI3897 

- GAGTCTCCTCAAGACAGTGCTATCACCAGAGATATTAACCGCACATTTCCAGCTCATGACTACTTCAAGGACACAGGAGGAGATGGACAAGATTCTTT

ATATAAAATATGCAAG GCATATTCTGTGTATGATGAAGAGATTGGTTACTGCCAGGGCCAGTCCTTCCTCGCAGCTGTACTGCTTCTCCAC - UNI20

814 - ATGCCCGAAGAACAGGCATTCAGTGTTCTGGTCAAGATCATGTTTGACTATGGTCTCAGGGAACTTTTCAAACAAAATTTTGAAGATCTTCATT

GCAAGTTCTACCAGTTGGAGCGCCTTATGCAG GAATACATTCCTGACCTGTACAACCACTTCCTGGATATCAGCCTTGAAGCACACATGTACGCCTCCC

AGTGGTTCCTTACACTTTTCACTGCAAAATTCCCTCTCTACATGGTCTTCCATATCATCGACCTGCTCTTATGTGAG GGAATAAGTGTCATCTTTAATG

TCGCCCTTGGATTACTAAAG ACTTCCAAGGATGACTTGCTGTTGACAGACTTTGAGGGTGCCTTGAAGTTCTTCAGGGTTCAGCTCCCTAAAAGATACC

GCTCAGAAGAAAATGCAAAGAGGCTCATGGAGCTTGCCTGTAACACAAAGGTACAGCAACGTTTGCTCTAA
Translation
 - UNI10402 - - UNI17202 - - UNI30720 - MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLK - UNI1720

2 - IVGNGSEQQLQKELADVLMDPPMDDQPGERSQLDGEGDGPLSNQLSASSTINPVPLVGLPKPEMSLPVKPGQGD DSEVSSPFTPVADEDSVVFNK

LTYLGCASVNAPRSEVEALRMMSILRSQCQISLDVTLSVPNVSEGTVR RLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHV

FRCEIQEA - UNI4097 - VSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKEDDGKGYFS SAVPKDKDRQCFKLRQGIDKKIVIC

VQQTANKELAIER RCFGLLLSPGKDVRNSDMHLLDL ESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKD DKVLFMTTAVDLVITEVQEPVRFLLE

TKVRVCSPNERLFWPFSKRSTTENFFLKLKQ IKQKEKKNNADTLYEVVCLESESERERRKTTASPSVRLPQSGSQSSMIPSPPEDDEEED - UNI553

0 - DNDEPLLSGFGDVSKECAEKILETWGELLSKW WHLNLSVRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITK - UNI3897 -

 ESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICK AYSVYDEEIGYCQGQSFLAAVLLLH - UNI20814 - MPEEQAFSVLVKIMFDYGLRE

LFKQNFEDLHCKFYQLERLMQ EYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCE GISVIFNVALGLLK TSKDDLLLTDFEGA

LKFFRVQLPKRYRSEENAKRLMELACNTKVQQRLL
Transcript ENSMUST00000112920
Sequence
GGCGGAGCCTCCCTGACGGCGCTCGGCGGCAGCAG - UNI17202 - - UNI30720 - GCATTAAAAAAATATTTAACCATTCATGAGTTGAGCCT

CATTCTTGAGTTATGGATGACAAGGCCTCTGTTGGAAAAATCAGTGTCTCATCAGACTCAGTGTCTACTCTTAATAGTGAAGATTTTGTCTTGGTTTCCA

GGCAAGGAGATGAGACACCATCTACAAATAATGGGAGTGATGATGAGAAGACGGGACTCAAG - UNI17202 - ATTGTAGGAAATGGAAGTGAGCAG

CAGCTTCAGAAAGAGCTAGCAGATGTGCTGATGGATCCTCCCATGGACGACCAGCCAGGGGAAAGGTCACAACTGGATGGTGAAGGAGATGGGCCTCTTT

CTAATCAACTCTCAGCTTCATCCACCATTAATCCTGTGCCTCTGGTAGGGCTTCCGAAACCAGAGATGAGCCTGCCAGTGAAACCTGGACAAGGAG ATT

CTGAAGTATCAAGTCCTTTTACACCAGTGGCTGATGAGGATAGTGTGGTTTTCAATAAACTAACTTACTTAGGCTGTGCTTCAGTAAATGCTCCCCGGAG

TGAAGTGGAAGCCTTGAGGATGATGTCCATCTTGAGAAGTCAGTGTCAGATTTCTCTGGATGTAACCCTCTCAGTGCCGAATGTATCTGAAGGAACTGTG

AG ACTTTTAGATCCTCAAACAAACACTGAAATAGCAAACTACCCTATCTACAAAATCCTCTTCTGTGTCAGAGGACATGATGGGACTCCTGAGAGTGAC

TGTTTTGCATTCACTGAAAGTCACTACAACGCAGAGCTCTTCAGGATACATGTCTTTCGCTGTGAAATACAAGAAGCT - UNI4097 - GTGAGCCGG

ATACTTTACAGTTTTGCCACCGCCTTCCGCCGCTCTGCCAAGCAGACCCCACTCTCAGCCACAGCTGCACCACAGACTCCTGACAGCGACATCTTTACCT

TCTCTGTGTCTTTAGAAATAAAAGAAGATGATGGTAAAGGTTATTTTAG TGCTGTTCCCAAAGACAAGGACAGGCAATGCTTTAAACTTCGACAAGGAA

TTGATAAGAAGATTGTTATCTGTGTGCAGCAAACAGCTAACAAAGAACTTGCCATTGAAAG GTGCTTTGGTCTTCTCCTTAGCCCAGGAAAAGATGTCC

GAAACAGTGATATGCACTTGCTGGATTTG GAGTCTATGGGCAAAAGTTCAGATGGAAAATCATATGTTATTACTGGAAGCTGGAACCCGAAATCCCCAC

ATTTTCAAGTTGTGAATGAAGAAACTCCTAAAG ATAAAGTGCTGTTCATGACAACAGCTGTGGATTTGGTGATAACTGAAGTACAGGAACCTGTTCGAT

TTCTTCTAGAGACAAAAGTTCGAGTGTGCTCACCTAATGAAAGGTTATTCTGGCCCTTCAGCAAACGAAGCACTACTGAAAACTTCTTTCTGAAACTGAA

GCAG ATAAAGCAAAAGGAGAAAAAGAATAATGCTGACACTTTATATGAAGTTGTGTGTTTGGAGAGTGAGTCAGAGAGAGAGAGGAGGAAAACCACAGC

CAGTCCTTCAGTTCGCCTGCCACAGTCTGGATCCCAGAGCTCCATGATCCCCTCTCCCCCAGAAGATGATGAAGAAGAAG - UNI5530 - ATAATGA

TGAACCTCTCTTGAGTGGATTTGGGGATGTATCCAAAGAATGTGCAGAAAAAATTCTTGAAACATGGGGAGAACTGCTGTCAAAATG GCATCTCAACTT

GAGTGTGAGACCGAAGCAGTTGTCATCCTTAGTGAGAAGTGGTGTTCCTGAAGCTCTTCGTGGAGAAGTCTGGCAGCTGCTAGCAGGCTGCCACAACAAC

GATCACTTAGTAGAAAAGTACCGAATTCTCATCACAAAG - UNI3897 - GAGTCTCCTCAAGACAGTGCTATCACCAGAGATATTAACCGCACATTT

CCAGCTCATGACTACTTCAAGGACACAGGAGGAGATGGACAAGATTCTTTATATAAAATATGCAAG GCATATTCTGTGTATGATGAAGAGATTGGTTAC

TGCCAGGGCCAGTCCTTCCTCGCAGCTGTACTGCTTCTCCAC - UNI20814 - ATGCCCGAAGAACAGGCATTCAGTGTTCTGGTCAAGATCATGTT

TGACTATGGTCTCAGGGAACTTTTCAAACAAAATTTTGAAGATCTTCATTGCAAGTTCTACCAGTTGGAGCGCCTTATGCAG GAATACATTCCTGACCT

GTACAACCACTTCCTGGATATCAGCCTTGAAGCACACATGTACGCCTCCCAGTGGTTCCTTACACTTTTCACTGCAAAATTCCCTCTCTACATGGTCTTC

CATATCATCGACCTGCTCTTATGTGAG GGAATAAGTGTCATCTTTAATGTCGCCCTTGGATTACTAAAG ACTTCCAAGGATGACTTGCTGTTGACAGA

CTTTGAGGGTGCCTTGAAGTTCTTCAGGGTTCAGCTCCCTAAAAGATACCGCTCAGAAGAAAATGCAAAGAGGCTCATGGAGCTTGCCTGTAACACAAAG

 ATTAGCCAGAAGAAGCTGAAGAAGTTTGAAAAAGAGTACCATACCATGAGGGAGCAGCAGGCCCAACAGGAAGACCCCATCGAGCGATTTGAG CGGGA

AAATAGGCGGCTGCAAGAAGCTAACATGAGGTTGGAACAGGAAAACGATGACTTAGCTCATGAACTAGTCACCAGCAAAATTGCATTGCGGAAGGACCTG

GATAAT GCAGAGGAAAAGGCAGATGCATTGAATAAGGAGCTGCTGATGACCAAGCAGAAGCTGATTGATGCAGAAGACGAGAAGAGGAGGTTAGAAGAG

GAGTCTGCACAG TTAAAGGAAATGTGCCGCCGGGAACTTGACAAGGCAGAATCAGAGATTAAAAAAAACAGCTCTATCATTGGTGACTATAAGCAG AT

TTGTTCTCAATTGAGTGAAAGACTGGAAAAGCAACAGACAGCCAATAAAGTGGAAATTGAGAAAATCCGG CAAAAGGTAGATGACTGTGACCGCTGCCG

AGACTTCTTCAACAAAGAAGGGCGAGTGAAGGGTATCAGCTCAGCCAAGGGAGTTTCAGATGAGGACACAGATGAAGAAAAAGAGACACTCAAGAACCAG

CTTCGGGAGATGGAGCTAGAGCTGGCACAAACCAAACTGCAGCTGGTAGAAGCTGAATGCAAGATCCAG GACTTGGAACACCACTTGGGCCTTGCCCTC

AGTGAGGTGCAGGCAGCCAAGAAGACCTGGTTTAACCGAACACTGAGCTCCATAAAGACAGCAACTGGTGTTCAAGGGAAAGAGACATGTTGAGAACAGC

TGCTGCCTCCAGACACCTCCAGAAAACACACCACCTTTTGTTGCCTTCTTTGGCCAGATGTGTGATTCTGTGATATGTTGCAGGACCAGAATGAACCTAG

GTCAGAGCTGTATAGTATATTGTTAGGTCAGTGGGCTAGGGCTCCTGCAGCAGGCTGCCAACCCAACTGATGCTTTGGGTATGCACCAGAGTCCTTCCTC

CTAGTGCCATTCAGGCCTCTTTTCTGTATAGGAAGGAACACTTCACACAGCCAGACTTGGGGAATACCCCAATGTATTGGGTTTTCTTTTTCTAAACCCT

TTAAAAAAATTGTGTGTGTGTGTGTGTATGTGTACACATATACACACATGCACACACTCTATCCTTTGAGTTGGGGAGCAGGGGTTCAGAAATTTGAGTA

ATTCTTATCTATCAGTGCCAGCAAAAGCCCCTAGGAGATGAGAAGCACTTTGAGTAGAAGGGTCTCATAGTCACAGTTCAAGTCACCTAATTTTTTTTTA

AACTAATATAGTGCATAGGTTTTGATTTGGAATTATTCATATTGCTGAGCAATTCTATGCAACTCTCATAGTCGTGTCTTTTTTTTTTTTTTAAACAAAA

CAAAACATTAGCTGCCAAACTACTTCTAAAGGCTGGAATGGGCCACATGACTGTGAGACTGAATCAATCATGACACGGACAGCTCTTATTTTGTTTAAAG

TGTACATATATATGTGTGTGTATATATATGTGTGTGTGTATAAATATATATATATATATAGATATATATATAGATACATTTCCCAGTACCCTGAACTGAC

AGTGTTTAAGTCCCAGACAACCTGCTAATCTACCACTGCCGTCTGTGGTCATGGGGCACTTCCTTTCACTTGAGGTTTATTGGGCTTTGTTCTTCCTGCC

AATGTAGGAGCTGGCAAGAGCTCCATGACCTCTAATGTGTGCATAGCAGGTCGTTCAAGAGAGCAAGACTGAATACATGAAAGTCCCTACACACTGTAAA

GTCCTACTTTCCTGGCTGGATCTCTGTCAGGCCTCTGAAGCCTCCAGGGGGGCCAGGTGTACATCTCACTGGTCAGGTGATGGGCTGTGGATTCTCACTT

TAAAGCTATGAAATGGCAGTTTTAGCACCTTTTTTTTAATTAAAAACAAAACCTTTTGACTCTTAATTTATATGCTGACAAGTGGTGTCACAAGTGGCTC

ATCCTCTCTGCTCTGTGTGCAGGTAGCTTGGGTTTGTATATAAGGACACTAGTTATTTTTTCTTTCCCTGTTGGCTTTTCTAATGCTTGATGAGGTCATC

TACAGTGGGGAGATAATAAGTGGCCTGCTCTTCCCCAGACCATCCCCTACACCACTTCCTGTGTCTGTCTCGTTCAGTTAACCCAAACAGTATAAGCCCA

TCTTAAACTAGGTGTGTGGACATTGTGTGCTAGGGTAGTTTGTGTGTCAACTCCATGAACTGAAATATAAATCAGTAAAACTGTATTACTATTTCTTTTG

TTTGTTTTAACAGCATATTCATTAAATATTTTGGTACAAACAGCATTGCTTCATACAAAA
Translation
 - UNI17202 - - UNI30720 - MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLK - UNI17202 - IVGNGSEQQ

LQKELADVLMDPPMDDQPGERSQLDGEGDGPLSNQLSASSTINPVPLVGLPKPEMSLPVKPGQGD DSEVSSPFTPVADEDSVVFNKLTYLGCASVNAPR

SEVEALRMMSILRSQCQISLDVTLSVPNVSEGTVR RLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHVFRCEIQEA - UN

I4097 - VSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKEDDGKGYFS SAVPKDKDRQCFKLRQGIDKKIVICVQQTANKELAIER

 RCFGLLLSPGKDVRNSDMHLLDL ESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKD DKVLFMTTAVDLVITEVQEPVRFLLETKVRVCSPNERLF

WPFSKRSTTENFFLKLKQ IKQKEKKNNADTLYEVVCLESESERERRKTTASPSVRLPQSGSQSSMIPSPPEDDEEED - UNI5530 - DNDEPLLSG

FGDVSKECAEKILETWGELLSKW WHLNLSVRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITK - UNI3897 - ESPQDSAITRDI

NRTFPAHDYFKDTGGDGQDSLYKICK AYSVYDEEIGYCQGQSFLAAVLLLH - UNI20814 - MPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKF

YQLERLMQ EYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCE GISVIFNVALGLLK TSKDDLLLTDFEGALKFFRVQLPKRYR

SEENAKRLMELACNTK ISQKKLKKFEKEYHTMREQQAQQEDPIERFE RENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDN AEEKADALNKELL

MTKQKLIDAEDEKRRLEEESAQ LKEMCRRELDKAESEIKKNSSIIGDYKQ ICSQLSERLEKQQTANKVEIEKIR QKVDDCDRCRDFFNKEGRVKGIS

SAKGVSDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQ DLEHHLGLALSEVQAAKKTWFNRTLSSIKTATGVQGKETC
Transcript ENSMUST00000061179
Sequence
GGGGCGAGGCCAGGGAATCGGGCTGCGGAGGGTCGGCTTCGTGAGCTCTGCTGCTTGTGGTTCTTCGGTAGAAGGCGGGCCCGAGCTCTCTTCTTCGCGG

CTGCAGTCACGAAGTGCTCCCGCTGACCGTTGCCTGCATGGGCCTGAGCAGCCTGTCTGCGAACAAGCCGTG - UNI10402 - - UNI17202 - -

 UNI30720 - GCATTAAAAAAATATTTAACCATTCATGAGTTGAGCCTCATTCTTGAGTTATGGATGACAAGGCCTCTGTTGGAAAAATCAGTGTCTC

ATCAGACTCAGTGTCTACTCTTAATAGTGAAGATTTTGTCTTGGTTTCCAGGCAAGGAGATGAGACACCATCTACAAATAATGGGAGTGATGATGAGAAG

ACGGGACTCAAG - UNI17202 - ATTGTAGGAAATGGAAGTGAGCAGCAGCTTCAGAAAGAGCTAGCAGATGTGCTGATGGATCCTCCCATGGACGA

CCAGCCAGGGGAAAGGTCACAACTGGATGGTGAAGGAGATGGGCCTCTTTCTAATCAACTCTCAGCTTCATCCACCATTAATCCTGTGCCTCTGGTAGGG

CTTCCGAAACCAGAGATGAGCCTGCCAGTGAAACCTGGACAAGGAG ATTCTGAAGTATCAAGTCCTTTTACACCAGTGGCTGATGAGGATAGTGTGGTT

TTCAATAAACTAACTTACTTAGGCTGTGCTTCAGTAAATGCTCCCCGGAGTGAAGTGGAAGCCTTGAGGATGATGTCCATCTTGAGAAGTCAGTGTCAGA

TTTCTCTGGATGTAACCCTCTCAGTGCCGAATGTATCTGAAGGAACTGTGAG ACTTTTAGATCCTCAAACAAACACTGAAATAGCAAACTACCCTATCT

ACAAAATCCTCTTCTGTGTCAGAGGACATGATGGGACTCCTGAGAGTGACTGTTTTGCATTCACTGAAAGTCACTACAACGCAGAGCTCTTCAGGATACA

TGTCTTTCGCTGTGAAATACAAGAAGCT - UNI4097 - GTGAGCCGGATACTTTACAGTTTTGCCACCGCCTTCCGCCGCTCTGCCAAGCAGACCCC

ACTCTCAGCCACAGCTGCACCACAGACTCCTGACAGCGACATCTTTACCTTCTCTGTGTCTTTAGAAATAAAAGAAGATGATGGTAAAGGTTATTTTAG 

TGCTGTTCCCAAAGACAAGGACAGGCAATGCTTTAAACTTCGACAAGGAATTGATAAGAAGATTGTTATCTGTGTGCAGCAAACAGCTAACAAAGAACTT

GCCATTGAAAG GTGCTTTGGTCTTCTCCTTAGCCCAGGAAAAGATGTCCGAAACAGTGATATGCACTTGCTGGATTTG GAGTCTATGGGCAAAAGTTC

AGATGGAAAATCATATGTTATTACTGGAAGCTGGAACCCGAAATCCCCACATTTTCAAGTTGTGAATGAAGAAACTCCTAAAG ATAAAGTGCTGTTCAT

GACAACAGCTGTGGATTTGGTGATAACTGAAGTACAGGAACCTGTTCGATTTCTTCTAGAGACAAAAGTTCGAGTGTGCTCACCTAATGAAAGGTTATTC

TGGCCCTTCAGCAAACGAAGCACTACTGAAAACTTCTTTCTGAAACTGAAGCAG ATAAAGCAAAAGGAGAAAAAGAATAATGCTGACACTTTATATGAA

GTTGTGTGTTTGGAGAGTGAGTCAGAGAGAGAGAGGAGGAAAACCACAGCCAGTCCTTCAGTTCGCCTGCCACAGTCTGGATCCCAGAGCTCCATGATCC

CCTCTCCCCCAGAAGATGATGAAGAAGAAG - UNI5530 - ATAATGATGAACCTCTCTTGAGTGGATTTGGGGATGTATCCAAAGAATGTGCAGAAA

AAATTCTTGAAACATGGGGAGAACTGCTGTCAAAATG GCATCTCAACTTGAGTGTGAGACCGAAGCAGTTGTCATCCTTAGTGAGAAGTGGTGTTCCTG

AAGCTCTTCGTGGAGAAGTCTGGCAGCTGCTAGCAGGCTGCCACAACAACGATCACTTAGTAGAAAAGTACCGAATTCTCATCACAAAG - UNI3897 

- GAGTCTCCTCAAGACAGTGCTATCACCAGAGATATTAACCGCACATTTCCAGCTCATGACTACTTCAAGGACACAGGAGGAGATGGACAAGATTCTTT

ATATAAAATATGCAAG GCATATTCTGTGTATGATGAAGAGATTGGTTACTGCCAGGGCCAGTCCTTCCTCGCAGCTGTACTGCTTCTCCAC - UNI20

814 - ATGCCCGAAGAACAGGCATTCAGTGTTCTGGTCAAGATCATGTTTGACTATGGTCTCAGGGAACTTTTCAAACAAAATTTTGAAGATCTTCATT

GCAAGTTCTACCAGTTGGAGCGCCTTATGCAG GAATACATTCCTGACCTGTACAACCACTTCCTGGATATCAGCCTTGAAGCACACATGTACGCCTCCC

AGTGGTTCCTTACACTTTTCACTGCAAAATTCCCTCTCTACATGGTCTTCCATATCATCGACCTGCTCTTATGTGAG GGAATAAGTGTCATCTTTAATG

TCGCCCTTGGATTACTAAAG ACTTCCAAGGATGACTTGCTGTTGACAGACTTTGAGGGTGCCTTGAAGTTCTTCAGGGTTCAGCTCCCTAAAAGATACC

GCTCAGAAGAAAATGCAAAGAGGCTCATGGAGCTTGCCTGTAACACAAAG ATTAGCCAGAAGAAGCTGAAGAAGTTTGAAAAAGAGTACCATACCATGA

GGGAGCAGCAGGCCCAACAGGAAGACCCCATCGAGCGATTTGAG CGGGAAAATAGGCGGCTGCAAGAAGCTAACATGAGGTTGGAACAGGAAAACGATG

ACTTAGCTCATGAACTAGTCACCAGCAAAATTGCATTGCGGAAGGACCTGGATAAT GCAGAGGAAAAGGCAGATGCATTGAATAAGGAGCTGCTGATGA

CCAAGCAGAAGCTGATTGATGCAGAAGACGAGAAGAGGAGGTTAGAAGAGGAGTCTGCACAG TTAAAGGAAATGTGCCGCCGGGAACTTGACAAGGCAG

AATCAGAGATTAAAAAAAACAGCTCTATCATTGGTGACTATAAGCAG ATTTGTTCTCAATTGAGTGAAAGACTGGAAAAGCAACAGACAGCCAATAAAG

TGGAAATTGAGAAAATCCGG CAAAAGGTAGATGACTGTGACCGCTGCCGAGACTTCTTCAACAAAGAAGGGCGAGTGAAGGGTATCAGCTCAGCCAAGG

GAGTTTCAGATGAGGACACAGATGAAGAAAAAGAGACACTCAAGAACCAGCTTCGGGAGATGGAGCTAGAGCTGGCACAAACCAAACTGCAGCTGGTAGA

AGCTGAATGCAAGATCCAG GACTTGGAACACCACTTGGGCCTTGCCCTCAGTGAGGTGCAGGCAGCCAAGAAGACCTGGTTTAACCGAACACTGAGCTC

CATAAAGACAGCAACTGGTGTTCAAGGGAAAGAGACATGTTGAGAACAGCTGCTGCCTCCAGACACCTCCAGAAAACACACCACCTTTTGTTGCCTTCTT

TGGCCAGATGTGTGATTCTGTGATATGTTGCAGGACCAGAATGAACCTAGGTCAGAGCTGTATAGTATATTGTTAGGTCAGTGGGCTAGGGCTCCTGCAG

CAGGCTGCCAACCCAACTGATGCTTTGGGTATGCACCAGAGTCCTTCCTCCTAGTGCCATTCAGGCCTCTTTTCTGTATAGGAAGGAACACTTCACACAG

CCAGACTTGGGGAATACCCCAATGTATTGGGTTTTCTTTTTCTAAACCCTTTAAAAAAATTGTGTGTGTGTGTGTGTATGTGTACACATATACACACATG

CACACACTCTATCCTTTGAGTTGGGGAGCAGGGGTTCAGAAATTTGAGTAATTCTTATCTATCAGTGCCAGCAAAAGCCCCTAGGAGATGAGAAGCACTT

TGAGTAGAAGGGTCTCATAGTCACAGTTCAAGTCACCTAATTTTTTTTTAAACTAATATAGTGCATAGGTTTTGATTTGGAATTATTCATATTGCTGAGC

AATTCTATGCAACTCTCATAGTCGTGTCTTTTTTTTTTTTTTAAACAAAACAAAACATTAGCTGCCAAACTACTTCTAAAGGCTGGAATGGGCCACATGA

CTGTGAGACTGAATCAATCATGACACGGACAGCTCTTATTTTGTTTAAAGTGTACATATATATGTGTGTGTATATATATGTGTGTGTGTATAAATATATA

TATATATATAGATATATATATAGATACATTTCCCAGTACCCTGAACTGACAGTGTTTAAGTCCCAGACAACCTGCTAATCTACCACTGCCGTCTGTGGTC

ATGGGGCACTTCCTTTCACTTGAGGTTTATTGGGCTTTGTTCTTCCTGCCAATGTAGGAGCTGGCAAGAGCTCCATGACCTCTAATGTGTGCATAGCAGG

TCGTTCAAGAGAGCAAGACTGAATACATGAAAGTCCCTACACACTGTAAAGTCCTACTTTCCTGGCTGGATCTCTGTCAGGCCTCTGAAGCCTCCAGGGG

GGCCAGGTGTACATCTCACTGGTCAGGTGATGGGCTGTGGATTCTCACTTTAAAGCTATGAAATGGCAGTTTTAGCACCTTTTTTTTAATTAAAAACAAA

ACCTTTTGACTCTTAATTTATATGCTGACAAGTGGTGTCACAAGTGGCTCATCCTCTCTGCTCTGTGTGCAGGTAGCTTGGGTTTGTATATAAGGACACT

AGTTATTTTTTCTTTCCCTGTTGGCTTTTCTAATGCTTGATGAGGTCATCTACAGTGGGGAGATAATAAGTGGCCTGCTCTTCCCCAGACCATCCCCTAC

ACCACTTCCTGTGTCTGTCTCGTTCAGTTAACCCAAACAGTATAAGCCCATCTTAAACTAGGTGTGTGGACATTGTGTGCTAGGGTAGTTTGTGTGTCAA

CTCCATGAACTGAAATATAAATCAGTAAAACTGTATTACTATTTCTTTTGTTTGTTTTAACAGCATATTCATTAAATATTTTGGTACAAACAG
Translation
 - UNI10402 - - UNI17202 - - UNI30720 - MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLK - UNI1720

2 - IVGNGSEQQLQKELADVLMDPPMDDQPGERSQLDGEGDGPLSNQLSASSTINPVPLVGLPKPEMSLPVKPGQGD DSEVSSPFTPVADEDSVVFNK

LTYLGCASVNAPRSEVEALRMMSILRSQCQISLDVTLSVPNVSEGTVR RLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHV

FRCEIQEA - UNI4097 - VSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKEDDGKGYFS SAVPKDKDRQCFKLRQGIDKKIVIC

VQQTANKELAIER RCFGLLLSPGKDVRNSDMHLLDL ESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKD DKVLFMTTAVDLVITEVQEPVRFLLE

TKVRVCSPNERLFWPFSKRSTTENFFLKLKQ IKQKEKKNNADTLYEVVCLESESERERRKTTASPSVRLPQSGSQSSMIPSPPEDDEEED - UNI553

0 - DNDEPLLSGFGDVSKECAEKILETWGELLSKW WHLNLSVRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITK - UNI3897 -

 ESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICK AYSVYDEEIGYCQGQSFLAAVLLLH - UNI20814 - MPEEQAFSVLVKIMFDYGLRE

LFKQNFEDLHCKFYQLERLMQ EYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCE GISVIFNVALGLLK TSKDDLLLTDFEGA

LKFFRVQLPKRYRSEENAKRLMELACNTK ISQKKLKKFEKEYHTMREQQAQQEDPIERFE RENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDN 

AEEKADALNKELLMTKQKLIDAEDEKRRLEEESAQ LKEMCRRELDKAESEIKKNSSIIGDYKQ ICSQLSERLEKQQTANKVEIEKIR QKVDDCDRCR

DFFNKEGRVKGISSAKGVSDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQ DLEHHLGLALSEVQAAKKTWFNRTLSSIKTATGVQGKETC

For any suggestions or comments, please send an email to unitrap@crg.es