Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035439 (2410004L22Rik)
Chromosomal location
Chr 8: 73775024 - 73796275 (-)
Description
RIKEN cDNA 2410004L22 gene Gene [Source:MGI Symbol;Acc:MGI:1923728]
RefSeq_dna
NM_029621 
RefSeq_peptide
NP_083897.1 
MGI
MGI:1923728 
Uniprot/SWISSPROT
Q99L00 
Human Ortholog
ENSG00000131351 (AC020908.7)
Omim not available
UniTrap UNI27037
Vector Insertion
Chr 8: 73793184 - 73796182
Public Clones not available
Private Clones OST77195 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14889
Vector Insertion
Chr 8: 73786950 - 73793184
Public Clones PST3343-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7169
Vector Insertion
Chr 8: 73781325 - 73786950
Public Clones RRU416 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23951
Vector Insertion
Chr 8: 73775444 - 73776969
Public Clones not available
Private Clones OST239591 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035960
Sequence
ACTACTCCCTGCCTCCTAGCGGGCGGGACCCTGAGACGCTTGCCTTTGAGTGGAAGGCGGGAGAATGGCGGATTCCTCAGAACGGGACGCAGG - UNI1

4889 - - UNI27037 - GAAGTCTGCAGCTGCTGGTGCTTGTGCTGTTCCCAAGACAAAGGGAAGGAGAGTGCAAG - UNI14889 - GAAGAAG

AGTGGTGGAGTCCCGGTATCTGCAATATGACAAGAAAGCAAAAAAG - UNI7169 - - UNI14889 - GTTTCTGGAGCGGCCAAAGAAGAGAAGC

CACCTGAGGGAAGGAAAGCCAGCACAGTGCCTAGGAGCAGAG AGAGCCAAGTGATGGGGACAGGCAACCTGCAGTCTACCATGCTAGAAGGGCATGGCA

TGAATCCACCAGACCTAGACCTCTCTGCCATCGACG ACAAAATCTTGTCCAGGAAGGCTTCTTGGCCAGACAGGGAAATGACAGACAAAGCTAAGTCCA

CATCTTTTATCAGCTGTGACAAAAAAAGAATCCTTCGGAAGAAAAGACGG GATCTGCAGGAGACCATGGACATGATGGAGTCACAGACACTGCTGATGA

CCCTGCTGTCTGTGAAG ATGGAGAACAACCTGGCTCTGCTGGAGGAGAGGGCAGAGAAAGACTTGGCAGCCATGTGCCATGAGAAAGAGAGGTTGCAGA

GGCAGGCACTGGAGCTTCGGCGCCAGCTGCTTCTCCGGCAGAAACATCAGGAGCTGGCCGCCACCCTTGATGCCCAG ATTGAGGTGCTGAGTCCTCTTC

AGCCTGTGTTAGAGCGCTTCAAAGAGGAATACATGACACTGGGCAGAGCCCTGGACACCACGCGACACGAGCTGCCCATGCAGGCTGTCCACATGGAAGG

AAGTGGGCAGGAGCTCCTAG ATGATCTGGAGCCAGCCCTGAGGATCACCCTGCAGCTCCTGGGTGATCTGAGCATCTGCTCCCCATATGCCACTGCACA

GGTGCAGGGTGCCAGCGCACAGGAGCCTGGAGCCAGCACACAGCTGAGTTGTCTGCTGAAGGAACTGAAGGGCTTGGTCACTGAGAAAGACCTGGAGCTC

CGCAG - UNI23951 - ACTTGTCAGCCAGGTGGTAGAACTTTCCTCCCAGGCCAGTAAAGAAGCAGCTTTGATGAACCAGGAAGTCTGGGAAGAGGC

AGAGGGTGCCCTCACCAGCAGCCAGTGGTACTTCAGTCCAGATGCCTGCAGGGATGATAGTCCCTCTTAGGACAGGATGAATTACAGCAGGCCTGACCCT

TGATTGCCTCAGGCAGCCTGTCCTACCTGAGTATTTCCTAGCTGGCCTTTCTGCTCATTTATGTTTCCTCATGCCTCCTCCTTGTGGACCGAAGGAAGTT

TGGTGGTCCAGTATTCTGAAAGCTTGTGCACTTTGGTTTTGGTTTGCTTTGGTTTTTGTCTTGAGGTGGGAAGAAACACCAGTCTTGGCCACACCATCTG

CTGGGTTTGGGTTCTAAACTGAGTAAAGAAAGCAAGCTG
Translation
MADSSERDAG - UNI14889 - - UNI27037 - GKSAAAGACAVPKTKGRRVQG - UNI14889 - GRRVVESRYLQYDKKAKK - UNI7169

 - - UNI14889 - VSGAAKEEKPPEGRKASTVPRSRE ESQVMGTGNLQSTMLEGHGMNPPDLDLSAIDD DKILSRKASWPDREMTDKAKSTSFIS

CDKKRILRKKRR DLQETMDMMESQTLLMTLLSVK MENNLALLEERAEKDLAAMCHEKERLQRQALELRRQLLLRQKHQELAATLDAQ IEVLSPLQPV

LERFKEEYMTLGRALDTTRHELPMQAVHMEGSGQELLD DDLEPALRITLQLLGDLSICSPYATAQVQGASAQEPGASTQLSCLLKELKGLVTEKDLELR

R - UNI23951 - RLVSQVVELSSQASKEAALMNQEVWEEAEGALTSSQWYFSPDACRDDSPS
Transcript ENSMUST00000110071
Sequence
ACTACTCCCTGCCTCCTAGCGGGCGGGACCCTGAGACGCTTGCCTTTGAGTGGAAGGCGGGAGAATGGCGGATTCCTCAGAACGGGACGCAGG - UNI1

4889 - - UNI27037 - GAAGTCTGCAGCTGCTGGTGCTTGTGCTGTTCCCAAGACAAAGGGAAGGAGAGTGCAAG - UNI14889 - GAAGAAG

AGTGGTGGAGTCCCGGTATCTGCAATATGACAAGAAAGCAAAAAAG - UNI7169 - - UNI14889 - GTTTCTGGAGCGGCCAAAGAAGAGAAGC

CACCTGAGGGAAGGAAAGCCAGCACAGTGCCTAGGAGCAGAG AAGAGAGCCAAGTGATGGGGACAGGCAACCTGCAGTCTACCATGCTAGAAGGGCATG

GCATGAATCCACCAGACCTAGACCTCTCTGCCATCGACG ACAAAATCTTGTCCAGGAAGGCTTCTTGGCCAGACAGGGAAATGACAGACAAAGCTAAGT

CCACATCTTTTATCAGCTGTGACAAAAAAAGAATCCTTCGGAAGAAAAGACGG GATCTGCAGGAGACCATGGACATGATGGAGTCACAGACACTGCTGA

TGACCCTGCTGTCTGTGAAG ATGGAGAACAACCTGGCTCTGCTGGAGGAGAGGGCAGAGAAAGACTTGGCAGCCATGTGCCATGAGAAAGAGAGGTTGC

AGAGGCAGGCACTGGAGCTTCGGCGCCAGCTGCTTCTCCGGCAGAAACATCAGGAGCTGGCCGCCACCCTTGATGCCCAG ATTGAGGTGCTGAGTCCTC

TTCAGCCTGTGTTAGAGCGCTTCAAAGAGGAATACATGACACTGGGCAGAGCCCTGGACACCACGCGACACGAGCTGCCCATGCAGGCTGTCCACATGGA

AGGAAGTGGGCAGGAGCTCCTAG ATGATCTGGAGCCAGCCCTGAGGATCACCCTGCAGCTCCTGGGTGATCTGAGCATCTGCTCCCCATATGCCACTGC

ACAGGTGCAGGGTGCCAGCGCACAGGAGCCTGGAGCCAGCACACAGCTGAGTTGTCTGCTGAAGGAACTGAAGGGCTTGGTCACTGAGAAAGACCTGGAG

CTCCGCAG - UNI23951 - ACTTGTCAGCCAGGTGGTAGAACTTTCCTCCCAGGCCAGTAAAGAAGCAGCTTTGATGAACCAGGAAGTCTGGGAAGA

GGCAGAGGGTGCCCTCACCAGCAGCCAGTGGTACTTCAGTCCAGATGCCTGCAGGGATGATAGTCCCTCTTAGGACAGGATGAATTACAGCAGGCCTGAC

CCTTGATTGCCTCAGGCAGCCTGTCCTACCTGAGTATTTCCTAGCTGGCCTTTCTGCTCATTTATGTTTCCTCATGCCTCCTCCTTGTGGACCGAAGGAA

GTTTGGTGGTCCAGTATTCTGAAAGCTTGTGCACTTTGGTTTTGGTTTGCTTTGGTTTTTGTCTTGAGGTGGGAAGAAACACCAGTCTTGGCCACACCAT

CTGCTGGGTTTGGGTTCTAAACTGAGTAAAGAAAGCAAGCTG
Translation
MADSSERDAG - UNI14889 - - UNI27037 - GKSAAAGACAVPKTKGRRVQG - UNI14889 - GRRVVESRYLQYDKKAKK - UNI7169

 - - UNI14889 - VSGAAKEEKPPEGRKASTVPRSRE EESQVMGTGNLQSTMLEGHGMNPPDLDLSAIDD DKILSRKASWPDREMTDKAKSTSFI

SCDKKRILRKKRR DLQETMDMMESQTLLMTLLSVK MENNLALLEERAEKDLAAMCHEKERLQRQALELRRQLLLRQKHQELAATLDAQ IEVLSPLQP

VLERFKEEYMTLGRALDTTRHELPMQAVHMEGSGQELLD DDLEPALRITLQLLGDLSICSPYATAQVQGASAQEPGASTQLSCLLKELKGLVTEKDLEL

RR - UNI23951 - RLVSQVVELSSQASKEAALMNQEVWEEAEGALTSSQWYFSPDACRDDSPS

For any suggestions or comments, please send an email to unitrap@crg.es