Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035455 (Fignl1)
Chromosomal location
Chr 11: 11700291 - 11708935 (-)
fidgetin-like 1 Gene [Source:MGI (curated);Acc:Fignl1-001]
Human Ortholog
ENSG00000132436 (FIGNL1)
Omim not available
UniTrap UNI29864
Vector Insertion
Chr 11: 11706098 - 11708936
Public Clones (sanger) D077A06 (ggtc) E042B06 (ggtc) D083H10 (ggtc) PST22420-NR (escells)
IST12125H10 (tigm) IST14234H4 (tigm) IST13486F1 (tigm) IST14959B1 (tigm)
IST14215F10 (tigm) IST14711C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24678
Vector Insertion
Chr 11: 11700290 - 11703067
Public Clones not available
Private Clones OST210243 (lexicon) OST159078 (lexicon) OST133555 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31477
Vector Insertion
Chr 11: 11700290 - 11706219
Public Clones IST14313E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109664



































Transcript ENSMUST00000047689






























 - UNI29864 - - UNI31477 -  - UNI24678 - - UNI29864 - - UNI31477 - METSSSMSVETTRSVQVDEWQKNYCVVTSSICT








For any suggestions or comments, please send an email to