Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035492 (Dennd4a)
Chromosomal location
Chr 9: 64736767 - 64765395 (+)
Description
DENN/MADD domain containing 4A Gene [Source:MGI Symbol;Acc:MGI:2142979]
UniGene
Mm.222473 Mm.468918 
MGI
MGI:2142979 
Uniprot/SPTREMBL
Q8CBI8 Q5DTP4 
Human Ortholog
ENSG00000174485 (DENND4A)
Omim not available
UniTrap UNI35830
Vector Insertion
Chr 9: 64752147 - 64753807
Public Clones IST11850G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37350
Vector Insertion
Chr 9: 64754821 - 64754909
Public Clones CMHD-GT_437H11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13706
Vector Insertion
Chr 9: 64757507 - 64757737
Public Clones CMHD-GT_270D10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32690
Vector Insertion
Chr 9: 64760548 - 64764765
Public Clones IST10001D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038890
Sequence
AAGAGGCTTCAACGTAGGAACAGCAGCTTTTCAGTAAAACCCTCTGAAAAAACAGATGTTGTAACAGGCTTTGATCCTCTCTCGCTTTTGGTTGCTGAGA

CTGAGCAGCAGCAGAAAGTGGAAGAGGAAGAGGATGAAGATGATAACAAGAGCGTCTCAACACCATCTGCCAGGCGCAATTTAGCTGAAGAAATCGAGAT

GTACATGAATAACATGAGCAGTCCTTTGACAAGCCGCACACCCAGCATTGATTTACAACGAGCATGTGATGACAAGTTAACCAATAAGAAAAGCCCAACA

TTGGTCAAGGCCTGCAGAAGATCAAGCCTGCCTCCTAATTCTCCTAGGCCAGTGAGACTTACGAAATCCAAAAGTTACACCAAAAGTGAGGAGAGACCCA

GGGACAGACTGTGGTCCTCCCCAGCCTTCTCGCCCACGTGTCCATTTCGGGAAGGATCTCAAGAAACACTAGCCCATTCATCACCTTCATTTAACTTAGA

CACACTGCTGGTGCCTAAACTTGATGTCTTAAGGCACAGTGTGTTCACTGCTGGGAAAGGAGTTGCGGAGAAAGCAAGCAAATGGTACTCAAGGTTCACC

ATGTACACTACGTCATCAAAG GATCAAAGTTCTGATCGTACCAGTCTTTCTTCAGTGGGAGCCCAGGATTCTGAATCTACCTCTTTGACAGATGAAGAT

GTCTGCCACGAGTTGGAAGGAGCCACTTCCTCCCAAGAAAGCAGTGCGGCTTCGGGAACCAAGGGGATTGACGTCAGCAGGGCCAGCCTGGGAAGCTCTG

CCTCCTTAGAAG - UNI35830 - GATCCCTGTCAAAGTTTGCCTTGCCTGGAAAATCAGAGACTGCATCTTCTCTCAACACCAGTAACGCCAATATC

TTCCAGAACTACGCAATGGAG GTTCTCATCTCAAGTTGTTCTCGGTGTAGGACCTGCGACTGTCTTGTCCATGATGAGGAAATCATGGCTGGCTGGACA

GCAGATGATTCAAATCTCAATACTACATGTCCATTTTGTGGCAATCTCTTCCTACCCTTTCTGAATGTTGAAATCAGAGACTTAAGACGACCTGGGAG A

TATTTCTTGAAGTCCAGCTCATCAACAGAAACTATGCACTTTGCAAGTCGGACAAGGCAGTCTTGCATCTCAGCATCGGCCTCTGGTCTTGACACTTCTT

CTCTCTCGGTTCAAGGGAACTTTGATCTAAATAA CAAATCTAAACTGCAGGAAAATCCATGTGCCCGAAGTATTCAGATCCCTGCTCACAGATCAAAAA

CTGTTGTGTCAAAATGCCCGCTATTCCCAATGGCCAGAAGCATCAGCACATGTGGCCCCTTGGATAAGGACGATCCCGGAGGACAGAAGCTCATTCCTAC

AGGCAGCCTGCCAGCGACTTTACAAGGACATACA - UNI13706 - GATTCTTTAGGGTTAGAATGGCACCTGCCGAGTCCAGACCCTGTCACTGTCC

CATACCTTAGTCCCTTAGTGGTGTGGAAGGAACTTGAGAGCTTATTGGAGAATGAAGGTGACCATGCAATAACAGTGGCAGACTTTGTGGACCATCACCC

AATTGTCTTTTGGAACCTGGTGTGGTATTTTAGACGCCTCGACTTGCCCAGTAACCTGCCTGGACTGATTCTTTCTTCTGAGCATTGTAACAAGTATTCA

AAG ATTCCCCGCCACTGTATGTCTGAAGATAGCAAGTATGTTTTAATACAGATGTTATGGGACAACATGAAATTACATCAGGATCCAGGGCAACCCTTG

TACATCCTCTGGAATGCCCACA GTCAGAACCGCACTCTTCTGTTTGAGA CTCAAAAGTACCCAATGGTCCATTTGTTACAAAAAGGTGATGACTCCTT

TAACCAGGAACTGCTGAAAAGCATGGTGAAGAGCATTAAAATGAACGATGTCTATGGGCCCATGAGTCAGATTTTAGAGACTCTGAATAAGTGTCCGCAT

TTTAAAAGACAGCG GAGTTTATATAGAGAAATATTATTTCTCTCACTTGTGGCACTGGGAAGAGAAAACATTGATATAG - UNI32690 - ATGCAT

TTGACAAAGAATACAAGATGGCTTATGATCGTCTCACGCCGAGTCAAGTCAAGAGTACACATAACTGTGACAGGCCACCAAGTACTGGAGTGATGGAATG

CCGAAAAACCTTCGGAGAACCTTATCTTTAAGACGTGTGTGTATATGTATACATTCAATATATATTGTATAGTCAGTGTACAGAGTAACACTTTTAGACT

CTAAACTCCACTTTTTGAGAATGCATTTGTAAATGGATTAGAAAGTTCAGGTGACTTTGTACAGAATGCTTTTGTGGGACAACAGTGACAGACAGGGAGA

GAGCCACTTACTTACCGTTTGTTTCTTCTTTATCAGCCCTGTAAAGTAATTACATACTCTATGATGAGGAAGTCTCTTTTAAAAATGGGTAGCCACAAAA

TTAGACTGTCTTATGGTTTCTCATGGAAAAGACAGGTGGGAAAATCATGTACAGAGCGTAGGCAAAGATGTCAGATCAGAGTGTGTCCTGCTTTCGTGAA

CCGTTCATGGACAGTTCACGCTTTCGCCATGAAGTTCTATTATACATATTTTAAATTGTTTATAGTAAGTTGATATTTTTTTAATTTTTAAATTTAATAT

AGCAAACTTAAAATGACTTTAAAC
Translation
KRLQRRNSSFSVKPSEKTDVVTGFDPLSLLVAETEQQQKVEEEEDEDDNKSVSTPSARRNLAEEIEMYMNNMSSPLTSRTPSIDLQRACDDKLTNKKSPT

LVKACRRSSLPPNSPRPVRLTKSKSYTKSEERPRDRLWSSPAFSPTCPFREGSQETLAHSSPSFNLDTLLVPKLDVLRHSVFTAGKGVAEKASKWYSRFT

MYTTSSK DQSSDRTSLSSVGAQDSESTSLTDEDVCHELEGATSSQESSAASGTKGIDVSRASLGSSASLEG - UNI35830 - GSLSKFALPGKSET

ASSLNTSNANIFQNYAME VLISSCSRCRTCDCLVHDEEIMAGWTADDSNLNTTCPFCGNLFLPFLNVEIRDLRRPGR RYFLKSSSSTETMHFASRTRQ

SCISASASGLDTSSLSVQGNFDLNN NKSKLQENPCARSIQIPAHRSKTVVSKCPLFPMARSISTCGPLDKDDPGGQKLIPTGSLPATLQGHT - UNI1

3706 - DSLGLEWHLPSPDPVTVPYLSPLVVWKELESLLENEGDHAITVADFVDHHPIVFWNLVWYFRRLDLPSNLPGLILSSEHCNKYSK IPRHCMS

EDSKYVLIQMLWDNMKLHQDPGQPLYILWNAHS SQNRTLLFET TQKYPMVHLLQKGDDSFNQELLKSMVKSIKMNDVYGPMSQILETLNKCPHFKRQR

 RSLYREILFLSLVALGRENIDID - UNI32690 - DAFDKEYKMAYDRLTPSQVKSTHNCDRPPSTGVMECRKTFGEPYL
Transcript ENSMUST00000089035
Sequence
CTATCCCTCAGATGTGGTCTCGGTGTCTGCTGCGTCACTGTTATGGATTGTGGTTTATTTGTCTCCCAGCTTACGTGAAGGTTTGTCACTCCAAAGTCAG

GGCTCTGAAAACTGCATACGATGTGCTTAAAAAAATGCAGCTGAAGAAGATGGATCCACCTGATGAGGTAATAGTGTGATTCCAAGGGTGTCGATTATTA

GAGATGCCCGTGCAGAAGAGCGTTTGTGTCTGTTCACCTCTCAACTTGTGTTGCAGGTGTGCTACCGCATTCTCATGCAGCTCTGTGGACAGTACGACCA

GCCTGTACTTGCGGTTCGAGTGCTTTTTGAAATGCAGAAAGCTGGTATTGACCCCAATGCAATCACTTATGGATATTATAATAAG GCTGTTTTAGAAAG

TACGTGGCCTTCAAGAAGTCGTAGTGGCTATTTCCTCTGGACAAAAGTAAGAAATGTTGTTTTAGGAGTTGCACAGTTCAAAAGAGCTTTGAAGAAACAT

CCACACTTACCACAGACAGCGCTCTCAG GTGGCCGGTCTGATCTTGGATATAATTCATTATCTAAGGACAATGTTAGAAGAGAGGGTCCATCTACTGAA

GACATTCAAGGGGAAAAGGAGAAAAGAGGGAGTGATTCTAGTTCCT TGTCAGAAAATGAGAGTACAAAAGGAAGTGCGGAGTGCCTCCCTACTCTCAGT

TACCAGAGGGCTTCCACTATAGTTCGCCTCAACGGTGCACATAACGACAGTGCTGGTAAAACATCCGGAGAATGTGAGG AAAGCACACCTGAGCTGCTC

TTAATGCCATCTCTTGAGGACACAAATGAAGCACAAACCACGCCAAGCAGGTGCTTTAGGAAAAGGCATAAAAGTGATGATGGATCTCACTTGCAGCAGC

AAATGCCTTGGGGAAGCAGGAACCGTAATCTCAGTGGTGGGGTACTGATGGGATTCATGCTGAACAGAACTAACCAGGAAACAAGCCCTGGAGAGATGGT

TGAAAAATTAGGAGCTGATGCAAAAATTCTTTCAAATGTTATCTCAAAAAGCACAAGGCCAAATAGTCTTGATATTGGAAAACCACCCGCAAGATCAAAG

AGAGACAGCCTAGAGAAGGAGTCTAGCGACGATGACACACCTTTCCATGGTTCTAACTGCCTGGATAAAGTCGAGTCTCCTGTTATCTTTGACTTAGAAG

ATTTAGACACTGAAACAGATGGATCAAAAGTGGGCGGTGTCGCTGCACAAAATCCCAAGAGGCTTCAACGTAGGAACAGCAGCTTTTCAGTAAAACCCTC

TGAAAAAACAGATGTTGTAACAGGCTTTGATCCTCTCTCGCTTTTGGTTGCTGAGACTGAGCAGCAGCAGAAAGTGGAAGAGGAAGAGGATGAAGATGAT

AACAAGAGCGTCTCAACACCATCTGCCAGGCGCAATTTAGCTGAAGAAATCGAGATGTACATGAATAACATGAGCAGTCCTTTGACAAGCCGCACACCCA

GCATTGATTTACAACGAGCATGTGATGACAAGTTAACCAATAAGAAAAGCCCAACATTGGTCAAGGCCTGCAGAAGATCAAGCCTGCCTCCTAATTCTCC

TAGGCCAGTGAGACTTACGAAATCCAAAAGTTACACCAAAAGTGAGGAGAGACCCAGGGACAGACTGTGGTCCTCCCCAGCCTTCTCGCCCACGTGTCCA

TTTCGGGAAGGATCTCAAGAAACACTAGCCCATTCATCACCTTCATTTAACTTAGACACACTGCTGGTGCCTAAACTTGATGTCTTAAGGCACAGTGTGT

TCACTGCTGGGAAAGGAGTTGCGGAGAAAGCAAGCAAATGGTACTCAAGGTTCACCATGTACACTACGTCATCAAAGGTAGGTTTGTGGGCTTTTGCTGC

TTCTGTAAGCCGCCTCCACCACAGCCACTTACAGCTTTCTTATGAGCACATCTGTCTTAACCACTCTCCTTACATACAGCTTATACAAGACAATGAGGGT

TTTTAAAGATCTTTTAAAGATTTATTTATTTTATATATGTGAGTACATTGTCAATCTCTTCAGACTCTCCAGAAGAGGGCATCAGATCCCATTACAGATG

GTTGTGAGCCACCATGTGGTTGCTGGGAATTGAACTTAAGACCTCTGGAAGAGCAGTCAGTGCTCTTAACTGCTGAGCCATCTCTCCAGCCCCTAAAGAT

TGGAATGCATATATGTGTGAGTTCATGTGAACCAACTGTGTGCAAGTGTCTCCAGAGGCCAGAAGAGGATGTAGGATTGCTAGAAACTATAGTTACACTC

AGTTGTGAGCTGCCACGCAGGTGCTGGGAACCAAATGCAGGTCCTCTGCAAGAGCAGTAAATGTCCTTCATTTCAGTATTTCCTTTAGCATATACATTTT

TGTCATTGTCCAGTATGTCTCCAAACATTACTCCCAGGAGTATGCTGCCTTCTCCTGGGCAGGATGAAGGATCTTATGATAGACTTGTATTTCTCCCAAG

AACAAAAATGTGGAGGAAGTATAGAAAGCATGTGTTTATAATCATCAGAGAAATGTCACAGATAGGGAGGGAACAGGAAGTCAAGAAATTACCCAAAGGA

ACTAAGTCAATAGTCTTTTTCCTCCGAAGGCATTTCCACTAATTGTGAGCATAGAACATTAAGTTTGCCATCTTTTGGGGGGGAGGAATGAAAGAGGGTG

GGAAGGGGACACAAAATGTAAACTTGAAGACTTCAGGGATGGAAGGTTTTGTCACCTGGCCTTTGGAAAGCCAGTGCTACCACTTGCCCGTGCTCTCCAG

GGTCCAATCAGACCTGTTATGTTTAATTCATCCAGCGGAGTGGCCACATCTCTCACCATAACTTTGTCTGACAGAGTTCTTCACATGTTCCCCTCTCAGT

GTTTTCCATCTTACAATATTAGAGAAAGACATGTCTTCTGGGCCTCTCCACCATGGTGTATTAGGTTTTAAGCAGTAAATCCATTCCAGCTTTCCAGTTT

TACTCAGCCTCAAAATCCCTTCATCAATACTAAACTAAGGGATATCAAGGCATCTCCAGTTCCTCCTCAGCAGGCTATCTTTTGACAAGTACTTTAGCCA

ACCAGCCAAACTCTCAGCACCTGCTTTAACTGTTCAAACTTTCATATGAAATCTCTGTTCAATGAGTCTCTGTTCAATGGGTCCATACTGATAAACCCAG

CCTAATCCTGTTTTTAGGTTCTTTCCATTATCCCACACCTGTAAAATCCATTCCCACACATTCCCTAGATTTCTCCTTGAATGAATGATTTCTTTAGTGG

TATAGATTACCTCCTTATGGACTACACTTTATATCTTACTTCTAGGAACCTGCTTAGACTTGTGTCTAGTTACATCTAGAGACAACAGTTGGTGGGCATT

GGAGAAATATCAGTGCAGGATTGATTCCCTTAGGCAGAGTTGGAGAGGGCAGTACTGCAAGGGGTGAGGAAGCACACTTTCCCGGTACTGATGCTGCATG

GGACAGGTAAGCAGAAAGCCTCTGAAAAGTAACGCTTAGGAGTTCTCTGGTGAGAAGAGCTAGCTAGCATCTGTGAGCTCCAAAGGGAGGAGCTCTGTCC

AGCAGGTCCCTGAACCCTGAGAGGCATGTGCCCAGGGCTAAGGAGTAAGTGCAGTGGCTGAGCTCTCTACTAGAATGCATGAGGCCTAAATTCAATCCCC

AGGTCTACTCCTCTCTCCTCCTAGACAATCTGTATCTTAGGGGCATTGACAATCCCTAGGTAGACTGTAAAACCTAGAATTGATTTGGCTCAATCTGTGA

TTAAATTACAATAATCAGTTTTTATTTAGCACAAGAAAGAATATACTCTTCTTGAAGGAATAAAATCCCTGGAGTCGTTATCAGAAGTAAGTAATGGAAA

CAGAACCCCAAAAGATCCAGATATTTGTATTAGCAAGGGACATTTAGGTAATTTTCAAATATCCAAGGAAATAAAGGAAAAGAAACAGAAATTATATAAA

TGGAGAATTTCACAAGGTAATGAGGATCTTTTGGAGGAAAAAGAAGAAACAAGTGTAAACCATAAAACTGAAAAATAAATTGAGAACACAATAGATAAAT

TTGATAGCAAATAAAACAAATTGAAAGATTAGAGATGCCACTTAAAAATATCTGTACTGAATCAGAGATAGAAAAATACTTAAGAAATATAGATATGTAG

ATATCTAAGTTGGTATTCCTTGCCTTACAAGGACCTGAGTATGACCCCTAGACCTCACGTTAGAATCAACCAGCTATAGTGGTAGCACACTTGCAATCCC

AGTGCTGCCGGGCAGGGCGGGCGAGACAGGCAGATGCCTAGGGCCTGGCCAGCTAGCCTAGCCTATGTCCTGACTTCCAAGCAAGTAAGACTTTCAGGTT

GCTCTCTGTTGCTGTTGTAAAGACCATGACAGAGCAGTTTTAGAGAGGAAAAATATCTGTACTGAATCAGAGATAGAAAAATATTTAAGAAATATAGATA

TGTAGATATTGGCTTCGTGTTCCAATTACATTTCAGTCCATCTTTGAGGGAGGTCAGGGCAAGAACTCAAGGGCGAGAGCAGAGGCAGAGCCATGGAGGA

CACTCCTTACTAACCTGCTCCCATGAGTTGCTGATCCTGCTCCCTCTCGCCACTCAGGACGGCCTGCCCAGGGCCACCTCCACCCACAGCACTCCAAGGT

CTTTGCCCATAGATTTGCCTACAGGCTAATCTGATTGGGGCATTTTTAAATTGAGGTCCCTCTTCCCAGATAACTCTAGTTTGTGTCCTGTTGCTGGTGA

GGTGGGGGCACAAAACAAAACAAAAACAACCAGCACAAAGACCCAGTCCTAAAATAAATACAACAACAAAAATAGGCAAAGCCCTCATCAGGAGTCTCCC

GGCTTCAGCAGGCCTGGCACTTCCGGCTTCTGCGGGCACCCACACTCATGTGTACGTATCATCCATATAATTTAAATGGGTTAGGTTCTTGGCATGTGGG

AGCAGCACTCGAGGCTGTCCTCCCCCTCTGCGTGCACTCATCCTCCTGTGCAGCAAAAAGAAATGTTTAAAAACTTCAGGTGATAGTTTGAATCCACTGT

GATAGTGTAAGACAATTTCAGCCCATCCTACATCTATTTGCTATAAATAATAGAAAGTATATAAAAACAACTAAAAATTCTGCAAAGTAAGAAAGAACTG

ATGAAGTCCAAGGAAGGACCCCCACAGAGACAAGTTTCCTATTCTCTCTTCCAATACCTCCTGACCCCAAGGGCAGTTAAGTGGACCATCATAGCTCTAA

AAACTAAAGTCATGGGGTTGGGGATTTAGCTCAGTGGTAAAGTGCTTGCCTAGCAAGCCCAAGGCCCTGGGTTCGGTCCTCAGCTCCGG
Translation
GNSVIPRVSIIRDARAEERLCLFTSQLVLQVCYRILMQLCGQYDQPVLAVRVLFEMQKAGIDPNAITYGYYNK AVLESTWPSRSRSGYFLWTKVRNVVL

GVAQFKRALKKHPHLPQTALSG GGRSDLGYNSLSKDNVRREGPSTEDIQGEKEKRGSDSSSL LSENESTKGSAECLPTLSYQRASTIVRLNGAHNDSA

GKTSGECEE ESTPELLLMPSLEDTNEAQTTPSRCFRKRHKSDDGSHLQQQMPWGSRNRNLSGGVLMGFMLNRTNQETSPGEMVEKLGADAKILSNVISK

STRPNSLDIGKPPARSKRDSLEKESSDDDTPFHGSNCLDKVESPVIFDLEDLDTETDGSKVGGVAAQNPKRLQRRNSSFSVKPSEKTDVVTGFDPLSLLV

AETEQQQKVEEEEDEDDNKSVSTPSARRNLAEEIEMYMNNMSSPLTSRTPSIDLQRACDDKLTNKKSPTLVKACRRSSLPPNSPRPVRLTKSKSYTKSEE

RPRDRLWSSPAFSPTCPFREGSQETLAHSSPSFNLDTLLVPKLDVLRHSVFTAGKGVAEKASKWYSRFTMYTTSSKVGLWAFAASVSRLHHSHLQLSYEH

ICLNHSPYIQLIQDNEGF

For any suggestions or comments, please send an email to unitrap@crg.es