Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035517 (Tdrd7)
Chromosomal location
Chr 4: 45978256 - 46047633 (+)
Description
tudor domain containing 7 Gene [Source:MGI (curated);Acc:Tdrd7-001]
RefSeq_dna
NM_146142 
RefSeq_peptide
NP_666254.1 
UniGene
Mm.398671 Mm.408113 Mm.275413 
MGI
MGI:2140279 
Uniprot/SWISSPROT
Q8K1H1 
Uniprot/SPTREMBL
B1AWG7 Q3TTH8 Q3TTK4 B1AWH5 
Human Ortholog
ENSG00000196116 (TDRD7)
Omim not available
UniTrap UNI29560
Vector Insertion
Chr 4: 46023774 - 46025937
Public Clones H001A09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102929
Sequence
GTCTGCGCAGAGCTAAGCCGGCCGGCGAAGGGGCGGGGCGTGGTGCGACGGGGCGTGGCCCAGAGGGCGGGGCTTTAGGTGATTCCCAAGCCACGGCTCA

GGCCGTGCGGGGAAACCGAAAGTGGGCGGCGGCCGCCCTGGCGGAGGGAGCGGAGGGAGCCGGGCCCAGAGGCGCGGGCTTGGGCCGCGGGTCCCCGGGA

CGAG GCAAAGATGCTGGAGGCAGATCTGGTTTCAAAGATGCTAAGGGCTGTCCTGCAGTCTCATAAGAACGGGATCGTATTACCCCGTCTCCAAGGAGA

GTACCGATCTTTGACTGGAGACTGGATCCCCTTCAAGCAGCTGGGCTACCCTACTTTGGAAGCCTACCTGAGAAGCGTGCCAGCAGTTGTCAGGATAGAG

GCTAGTAGATCTGGAGAG ATCGTCTGCTATGCAGTAGCCTGCACAGAAACTGCAAGGATCGCTCAGCTTGTGGCTCGTCAGAGGACCTCTAAAAGGAAA

ATAGGGCGACAAATTAATTGTCAGATGAGAGTGAAGAAAGCCATGCCGTTCTTTCTAGAAG GAAAGCCAAAGGCAACTCTCAGACAACCAGGATTTGCC

TCAGATTATTCCATCAGCAGGAAACCTAATTCAGCGCTGTTAAGAGACAGAGGAAGCGCCTTGGGAGTTAAGGCTGACGTGGACATGCCGCCGTACCCAG

ACACTCCAGTGCAGAGGCACGCGAGCATGTCTGCCAATAGCAG GTTCAGTCCAAAGTCATCCTTGCCAGCGTCTTTCCAGACACACATCTCAAGGGCCT

GCCCTACGGAAGTCAATG ATAATTTAAATCAGACTGTTGAGAAACCAAATATCACGCCTCCTGCCTCTTACACTAATAAGATGGATGAGGTTCAAAACC

GCATAAAGGAAATATTAGACAAGCATAACAATGGCATTTGGATATCTAAGCTTCCACATTTTTACAAAGAGTTTTATAAAGAAGACCTTAACCAAGGAGT

TTTACAGCAGTTTGAACACTGGCCTCACATTTGCACG GTGGAAAAACCTTGTGGTGGTGGTCAAGATTCACTTCTTTATCCTGCCAGGAGAGAGCAGCC

CCTGAAAAGTGACCAGGACCCTGAGAAGGAGCTCCCACCTCCACCTCCTGCTCCCAAGCAGGAGGTTCCATCCCAAGGGAGCCCAGCAGTGATGCCAGAT

GTCAAGGAGAAAGTGGCAGAACTGCTGGGCAAGTACTCAAGTGGCCTTTGGGCAAGTGCGCTCCCCAAAGCATTTGAGGACATGTACAAAGTCAAGTTCC

CTGAGGATGCCTTAAAAAATCTCGCCTCGCTCTCTGATGTGTGCACCATAAACTACATTTCTGGAAACACCCAGAAGGCAATTCTCTATGCGAAACTCCC

ATTGCCCACTGACAAGATCTTAAAGGATGAAGGGCAGGCACAAGGAGATTTTGACATCAAGTCGATGATTGAACAAGAGTATTTGCAGATAGAAAAAAAC

ATGGCTGAAAGTGCTGATGAGTTTCTGGAGGACATAACTGTGCCGCCTCTGGTAATTCCTACCGAGGCCTCACCGTCTGTGTTGGTGGTTGAGCTGAGCA

ACACAAATGATGTGGTTATCAG GTATGTAGGCAAAGACTACTCAGCTGCTCAGGAACTGATGGAGGATGAGATGAAGGAGTTTTACAGTAAGAACCCCA

GAGTCACACCGATCCAGACTGTGCACGTGGGGCAGCTGCTGGCAGTCAATGCAGAGGAGGATGCCTGGTTGCGAGCACAGATCATTTCCACGGATGAGAA

CAAGATAAAG GTGTGCTATGTTGACTATGGCTTTTGTGAAAACATTGAGAAGAGTAAAGCGTACAGACTGAACCCACGGTTCTGCTCGCTTTCCTTTCA

AGCCACCAAGTGCAAGCTGGCAG - UNI29560 - GGTTGGAGGTTCTGAATGATGACCCTGACCTTGTGAAGGCGGTGGAATCACTAACATGTGGGA

AGATCTTTGCTGTGGAGATCCTGGACAAGTCAGATGTCCCGCTGGTGGTGCTGTACGACACGTCAGGAGAGGACGATATCAACATCAATGCCACCTGCCT

CAAGGCAATATGTGACAGATCTCTACAAGTTCATCTCCAG GTGGATGCCATGTACACAAATGTCAAAGTGACCAACATTTGCTCTGATGGAACACTCTA

CTGCCAGGTGCCCTGCAAGGGTCTGAATAAACTCAATGACCTTCTGCATAAGACAGAGGACTACTTCCACTGCAAG CACATGACCTCTGAGTACTTCAT

CTCGCTACCCTTCTGTGGGAAGATCTGCCTCTTCCATTGCAAAGGGAAATGGTTACGAGTGGAG ATCACTAATGTTCATAGCAGCCGTGCACTCGACGT

TCAGTTCCTGGACTCTGGCAATTCGACATCCGTGAAAGTGTCAGAACTCAGAGAAATCCCACCGCGGTTCCTGCAGGAAATGCTTGCCATACCCCCTCAG

 GCTATAAAGTGCTGCTTGGCTGATCTTCCACAGTCCATTGGCATGTGGACACCAGATGCTGTTCTGTGGTTAAGAGATTCTGTTTTGAATTGCTCGGAC

TGTAGTATTAAG GTTACAAAAATGGATGAGACCAAGGGGGTTGCCTATGTGTACTTATTCACTCCCAATAACTTCCCGGATCCCCATCGCAGTATTAAC

CGGCAGATCACAAACGCAGACCTGTGGAAACATCAGAAGGATGTGTTTCTGAGCGCGGTGTCTACTGCGGCCAGTTCCCCTGGCAACAGGAATGGTGGCA

CACCTGCTCCGGGCAGCCCTGCAGAGAGTCTCAGAAAGAGCCACCCAGAGGTTATCAAGAAGTCTGTCCTGGACCATACCAGCTCTTTCTCCTTGGAGGA

ACTGCCCCCTCCTGTCCACCTGTCAAGGTCAGGGGAACACATGGATGTGTATGTGCCTGTGGCCTGTCACCCAGGCCATTTTGTCATCCAGCCCTGGCAG

GAGATCCATAAGCTAGAAGTGCTGATGGAAGAGATGATCCTGTACTACAGCGTGTCCGAGGAGCGCCACATAGCGGTGGAGCGAGACCAAGTGTACGCAG

CCAAAGTGGAGAATAA GTGGTACAGGGTACTTTTAAAAGGAATCCTGACCAATGGGCTGGTGTCTGTGTACGAGCTGGACTACGGCAAGCATGAGCTCG

TCAACATAAGGAAAGTGCAGCCCCTAGTGGACGTGTTCCGAAAGCTGCCCTTCCAGGCGGTCACCGCTCAACTGGCAG GCGTGAAGTGCAGCCAGTGGT

CGGAGGAGGCTTCGATGGTGTTTCGAAATCACGTGGAGAAGAAAGCCCTGGTGGCGTTGGTGCAGACAGTTGTTGAGCACACTAATCCTTGGGACCGGAA

AGTGGTGCTCTATCTCGTAGACACGTCGCTGCCCGACACTGACACCTGGATTCATGACTTTATGTCACAGTATCTGCTAGAGCTTTCGAAAGTTAATTAA

TCACTGCTTGAGATGTTGACCGCTAATGAGATTGTTCTCAAAGCAATAATACAAAATGTGTAGGAGGGTCTTAAAACATCTTATTTTTACTACATGGCTC

TGACTGTTGTGGAGGATTGAAAAGAATATGCTTTGTTTGATGAAAGATATTTAACAAGTTTTGTTTAATGCAGTTGACTTTTCAAAGAAAAATTGCACTT

GAATTATTAATATAATATTAGAATAAAATGTTTAGCAATATAAAA
Translation
 MLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGE IVCYAVACTETARIAQLVARQRTSKRKIG

RQINCQMRVKKAMPFFLEG GKPKATLRQPGFASDYSISRKPNSALLRDRGSALGVKADVDMPPYPDTPVQRHASMSANSR RFSPKSSLPASFQTHISR

ACPTEVND DNLNQTVEKPNITPPASYTNKMDEVQNRIKEILDKHNNGIWISKLPHFYKEFYKEDLNQGVLQQFEHWPHICT VEKPCGGGQDSLLYPAR

REQPLKSDQDPEKELPPPPPAPKQEVPSQGSPAVMPDVKEKVAELLGKYSSGLWASALPKAFEDMYKVKFPEDALKNLASLSDVCTINYISGNTQKAILY

AKLPLPTDKILKDEGQAQGDFDIKSMIEQEYLQIEKNMAESADEFLEDITVPPLVIPTEASPSVLVVELSNTNDVVIR RYVGKDYSAAQELMEDEMKEF

YSKNPRVTPIQTVHVGQLLAVNAEEDAWLRAQIISTDENKIK VCYVDYGFCENIEKSKAYRLNPRFCSLSFQATKCKLAG - UNI29560 - GLEVL

NDDPDLVKAVESLTCGKIFAVEILDKSDVPLVVLYDTSGEDDININATCLKAICDRSLQVHLQ VDAMYTNVKVTNICSDGTLYCQVPCKGLNKLNDLLH

KTEDYFHCK HMTSEYFISLPFCGKICLFHCKGKWLRVE ITNVHSSRALDVQFLDSGNSTSVKVSELREIPPRFLQEMLAIPPQ AIKCCLADLPQSIG

MWTPDAVLWLRDSVLNCSDCSIK VTKMDETKGVAYVYLFTPNNFPDPHRSINRQITNADLWKHQKDVFLSAVSTAASSPGNRNGGTPAPGSPAESLRKS

HPEVIKKSVLDHTSSFSLEELPPPVHLSRSGEHMDVYVPVACHPGHFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVERDQVYAAKVENK KWYRVLL

KGILTNGLVSVYELDYGKHELVNIRKVQPLVDVFRKLPFQAVTAQLAG GVKCSQWSEEASMVFRNHVEKKALVALVQTVVEHTNPWDRKVVLYLVDTSL

PDTDTWIHDFMSQYLLELSKVN
Transcript ENSMUST00000043784
Sequence
AGGCAAAGATGCTGGAGGCAGATCTGGTTTCAAAGATGCTAAGGGCTGTCCTGCAGTCTCATAAGAACGGGATCGTATTACCCCGTCTCCAAGGAGAGTA

CCGATCTTTGACTGGAGACTGGATCCCCTTCAAGCAGCTGGGCTACCCTACTTTGGAAGCCTACCTGAGAAGCGTGCCAGCAGTTGTCAGGATAGAGGCT

AGTAGATCTGGAGAG ATCGTCTGCTATGCAGTAGCCTGCACAGAAACTGCAAGGATCGCTCAGCTTGTGGCTCGTCAGAGGACCTCTAAAAGGAAAATA

GGGCGACAAATTAATTGTCAGATGAGAGTGAAGAAAGCCATGCCGTTCTTTCTAGAAG GAAAGCCAAAGGCAACTCTCAGACAACCAGGATTTGCCTCA

GATTATTCCATCAGCAGGAAACCTAATTCAGCGCTGTTAAGAGACAGAGGAAGCGCCTTGGGAGTTAAGGCTGACGTGGACATGCCGCCGTACCCAGACA

CTCCAGTGCAGAGGCACGCGAGCATGTCTGCCAATAGCAG GTTCAGTCCAAAGTCATCCTTGCCAGCGTCTTTCCAGACACACATCTCAAGGGCCTGCC

CTACGGAAGTCAATG ATAATTTAAATCAGACTGTTGAGAAACCAAATATCACGCCTCCTGCCTCTTACACTAATAAGATGGATGAGGTTCAAAACCGCA

TAAAGGAAATATTAGACAAGCATAACAATGGCATTTGGATATCTAAGCTTCCACATTTTTACAAAGAGTTTTATAAAGAAGACCTTAACCAAGGAGTTTT

ACAGCAGTTTGAACACTGGCCTCACATTTGCACG GTGGAAAAACCTTGTGGTGGTGGTCAAGATTCACTTCTTTATCCTGCCAGGAGAGAGCAGCCCCT

GAAAAGTGACCAGGACCCTGAGAAGGAGCTCCCACCTCCACCTCCTGCTCCCAAGCAGGAGGTTCCATCCCAAGGGAGCCCAGCAGTGATGCCAGATGTC

AAGGAGAAAGTGGCAGAACTGCTGGGCAAGTACTCAAGTGGCCTTTGGGCAAGTGCGCTCCCCAAAGCATTTGAGGACATGTACAAAGTCAAGTTCCCTG

AGGATGCCTTAAAAAATCTCGCCTCGCTCTCTGATGTGTGCACCATAAACTACATTTCTGGAAACACCCAGAAGGCAATTCTCTATGCGAAACTCCCATT

GCCCACTGACAAGATCTTAAAGGATGAAGGGCAGGCACAAGGAGATTTTGACATCAAGTCGATGATTGAACAAGAGTATTTGCAGATAGAAAAAAACATG

GCTGAAAGTGCTGATGAGTTTCTGGAGGACATAACTGTGCCGCCTCTGGTAATTCCTACCGAGGCCTCACCGTCTGTGTTGGTGGTTGAGCTGAGCAACA

CAAATGATGTGGTTATCAG GTATGTAGGCAAAGACTACTCAGCTGCTCAGGAACTGATGGAGGATGAGATGAAGGAGTTTTACAGTAAGAACCCCAGAG

TCACACCGATCCAGACTGTGCACGTGGGGCAGCTGCTGGCAGTCAATGCAGAGGAGGATGCCTGGTTGCGAGCACAGATCATTTCCACGGATGAGAACAA

GATAAAG GTGTGCTATGTTGACTATGGCTTTTGTGAAAACATTGAGAAGAGTAAAGCGTACAGACTGAACCCACGGTTCTGCTCGCTTTCCTTTCAAGC

CACCAAGTGCAAGCTGGCAG - UNI29560 - GGTTGGAGGTTCTGAATGATGACCCTGACCTTGTGAAGGCGGTGGAATCACTAACATGTGGGAAGA

TCTTTGCTGTGGAGATCCTGGACAAGTCAGATGTCCCGCTGGTGGTGCTGTACGACACGTCAGGAGAGGACGATATCAACATCAATGCCACCTGCCTCAA

GGCAATATGTGACAGATCTCTACAAGTTCATCTCCAG GTGGATGCCATGTACACAAATGTCAAAGTGACCAACATTTGCTCTGATGGAACACTCTACTG

CCAGGTGCCCTGCAAGGGTCTGAATAAACTCAATGACCTTCTGCATAAGACAGAGGACTACTTCCACTGCAAG CACATGACCTCTGAGTACTTCATCTC

GCTACCCTTCTGTGGGAAGATCTGCCTCTTCCATTGCAAAGGGAAATGGTTACGAGTGGAG ATCACTAATGTTCATAGCAGCCGTGCACTCGACGTTCA

GTTCCTGGACTCTGGCAATTCGACATCCGTGAAAGTGTCAGAACTCAGAGAAATCCCACCGCGGTTCCTGCAGGAAATGCTTGCCATACCCCCTCAG GC

TATAAAGTGCTGCTTGGCTGATCTTCCACAGTCCATTGGCATGTGGACACCAGATGCTGTTCTGTGGTTAAGAGATTCTGTTTTGAATTGCTCGGACTGT

AGTATTAAG GTTACAAAAATGGATGAGACCAAGGGGGTTGCCTATGTGTACTTATTCACTCCCAATAACTTCCCGGATCCCCATCGCAGTATTAACCGG

CAGATCACAAACGCAGACCTGTGGAAACATCAGAAGGATGTGTTTCTGAGCGCGGTGTCTACTGCGGCCAGTTCCCCTGGCAACAGGAATGGTGGCACAC

CTGCTCCGGGCAGCCCTGCAGAGAGTCTCAGAAAGAGCCACCCAGAGGTTATCAAGAAGTCTGTCCTGGACCATACCAGCTCTTTCTCCTTGGAGGAACT

GCCCCCTCCTGTCCACCTGTCAAGGTCAGGGGAACACATGGATGTGTATGTGCCTGTGGCCTGTCACCCAGGCCATTTTGTCATCCAGCCCTGGCAGGAG

ATCCATAAGCTAGAAGTGCTGATGGAAGAGATGATCCTGTACTACAGCGTGTCCGAGGAGCGCCACATAGCGGTGGAGCGAGACCAAGTGTACGCAGCCA

AAGTGGAGAATAA GTGGTACAGGGTACTTTTAAAAGGAATCCTGACCAATGGGCTGGTGTCTGTGTACGAGCTGGACTACGGCAAGCATGAGCTCGTCA

ACATAAGGAAAGTGCAGCCCCTAGTGGACGTGTTCCGAAAGCTGCCCTTCCAGGCGGTCACCGCTCAACTGGCAG GCGTGAAGTGCAGCCAGTGGTCGG

AGGAGGCTTCGATGGTGTTTCGAAATCACGTGGAGAAGAAAGCCCTGGTGGCGTTGGTGCAGACAGTTGTTGAGCACACTAATCCTTGGGACCGGAAAGT

GGTGCTCTATCTCGTAGACACGTCGCTGCCCGACACTGACACCTGGATTCATGACTTTATGTCACAGTATCTGCTAGAGCTTTCGAAAGTTAATTAATCA

CTGCTTGAGATGTTGACCGCTAATGAGATTGTTCTCAAAGCAATAATACAAAATGTGTAGGAGGGTCTTAAAACATCTTATTTTTACTACATGGCTCTGA

CTGTTGTGGAGGATTGAAAAGAATATGCTTTGTTTGATGAAAGATATTTAACAAGTTTTGTTTAATGCAGTTGACTTTTCAAAGAAAAATTGCACTTGAA

TTATTAATATAATATTAGAATAAAATGTTTAGCAAT
Translation
MLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASRSGE IVCYAVACTETARIAQLVARQRTSKRKIGR

QINCQMRVKKAMPFFLEG GKPKATLRQPGFASDYSISRKPNSALLRDRGSALGVKADVDMPPYPDTPVQRHASMSANSR RFSPKSSLPASFQTHISRA

CPTEVND DNLNQTVEKPNITPPASYTNKMDEVQNRIKEILDKHNNGIWISKLPHFYKEFYKEDLNQGVLQQFEHWPHICT VEKPCGGGQDSLLYPARR

EQPLKSDQDPEKELPPPPPAPKQEVPSQGSPAVMPDVKEKVAELLGKYSSGLWASALPKAFEDMYKVKFPEDALKNLASLSDVCTINYISGNTQKAILYA

KLPLPTDKILKDEGQAQGDFDIKSMIEQEYLQIEKNMAESADEFLEDITVPPLVIPTEASPSVLVVELSNTNDVVIR RYVGKDYSAAQELMEDEMKEFY

SKNPRVTPIQTVHVGQLLAVNAEEDAWLRAQIISTDENKIK VCYVDYGFCENIEKSKAYRLNPRFCSLSFQATKCKLAG - UNI29560 - GLEVLN

DDPDLVKAVESLTCGKIFAVEILDKSDVPLVVLYDTSGEDDININATCLKAICDRSLQVHLQ VDAMYTNVKVTNICSDGTLYCQVPCKGLNKLNDLLHK

TEDYFHCK HMTSEYFISLPFCGKICLFHCKGKWLRVE ITNVHSSRALDVQFLDSGNSTSVKVSELREIPPRFLQEMLAIPPQ AIKCCLADLPQSIGM

WTPDAVLWLRDSVLNCSDCSIK VTKMDETKGVAYVYLFTPNNFPDPHRSINRQITNADLWKHQKDVFLSAVSTAASSPGNRNGGTPAPGSPAESLRKSH

PEVIKKSVLDHTSSFSLEELPPPVHLSRSGEHMDVYVPVACHPGHFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVERDQVYAAKVENK KWYRVLLK

GILTNGLVSVYELDYGKHELVNIRKVQPLVDVFRKLPFQAVTAQLAG GVKCSQWSEEASMVFRNHVEKKALVALVQTVVEHTNPWDRKVVLYLVDTSLP

DTDTWIHDFMSQYLLELSKVN
Transcript ENSMUST00000107777
Sequence
ATGAGGAGCCAGCAGTCTACAACCCAGAGGAGGGTCCTCAGCAGAACCGGACCAAGCTGGCACCCGGATCCTGGACTTTCAGCCTCCAGAACC GCAAAG

ATGCTGGAGGCAGATCTGGTTTCAAAGATGCTAAGGGCTGTCCTGCAGTCTCATAAGAACGGGATCGTATTACCCCGTCTCCAAGGAGAGTACCGATCTT

TGACTGGAGACTGGATCCCCTTCAAGCAGCTGGGCTACCCTACTTTGGAAGCCTACCTGAGAAGCGTGCCAGCAGTTGTCAGGATAGAGGCTAGTAGATC

TGGAGAG ATCGTCTGCTATGCAGTAGCCTGCACAGAAACTGCAAGGATCGCTCAGCTTGTGGCTCGTCAGAGGACCTCTAAAAGGAAAATAGGGCGACA

AATTAATTGTCAGATGAGAGTGAAGAAAGCCATGCCGTTCTTTCTAGAAG GAAAGCCAAAGGCAACTCTCAGACAACCAGGATTTGCCTCAGATTATTC

CATCAGCAGGAAACCTAATTCAGCGCTGTTAAGAGACAGAGGAAGCGCCTTGGGAGTTAAGGCTGACGTGGACATGCCGCCGTACCCAGACACTCCAGTG

CAGAGGCACGCGAGCATGTCTGCCAATAGCAG GTTCAGTCCAAAGTCATCCTTGCCAGCGTCTTTCCAGACACACATCTCAAGGGCCTGCCCTACGGAA

GTCAATG ATAATTTAAATCAGACTGTTGAGAAACCAAATATCACGCCTCCTGCCTCTTACACTAATAAGATGGATGAGGTTCAAAACCGCATAAAGGAA

ATATTAGACAAGCATAACAATGGCATTTGGATATCTAAGCTTCCACATTTTTACAAAGAGTTTTATAAAGAAGACCTTAACCAAGGAGTTTTACAGCAGT

TTGAACACTGGCCTCACATTTGCACG GTGGAAAAACCTTGTGGTGGTGGTCAAGATTCACTTCTTTATCCTGCCAGGAGAGAGCAGCCCCTGAAAAGTG

ACCAGGACCCTGAGAAGGAGCTCCCACCTCCACCTCCTGCTCCCAAGCAGGAGGTTCCATCCCAAGGGAGCCCAGCAGTGATGCCAGATGTCAAGGAGAA

AGTGGCAGAACTGCTGGGCAAGTACTCAAGTGGCCTTTGGGCAAGTGCGCTCCCCAAAGCATTTGAGGACATGTACAAAGTCAAGTTCCCTGAGGATGCC

TTAAAAAATCTCGCCTCGCTCTCTGATGTGTGCACCATAAACTACATTTCTGGAAACACCCAGAAGGCAATTCTCTATGCGAAACTCCCATTGCCCACTG

ACAAGATCTTAAAGGATGAAGGGCAGGCACAAGGAGATTTTGACATCAAGTCGATGATTGAACAAGAGTATTTGCAGATAGAAAAAAACATGGCTGAAAG

TGCTGATGAGTTTCTGGAGGACATAACTGTGCCGCCTCTGGTAATTCCTACCGAGGCCTCACCGTCTGTGTTGGTGGTTGAGCTGAGCAACACAAATGAT

GTGGTTATCAG GTATGTAGGCAAAGACTACTCAGCTGCTCAGGAACTGATGGAGGATGAGATGAAGGAGTTTTACAGTAAGAACCCCAGAGTCACACCG

ATCCAGACTGTGCACGTGGGGCAGCTGCTGGCAGTCAATGCAGAGGAGGATGCCTGGTTGCGAGCACAGATCATTTCCACGGATGAGAACAAGATAAAG 

GTGTGCTATGTTGACTATGGCTTTTGTGAAAACATTGAGAAGAGTAAAGCGTACAGACTGAACCCACGGTTCTGCTCGCTTTCCTTTCAAGCCACCAAGT

GCAAGCTGGCAG - UNI29560 - GGTTGGAGGTTCTGAATGATGACCCTGACCTTGTGAAGGCGGTGGAATCACTAACATGTGGGAAGATCTTTGCT

GTGGAGATCCTGGACAAGTCAGATGTCCCGCTGGTGGTGCTGTACGACACGTCAGGAGAGGACGATATCAACATCAATGCCACCTGCCTCAAGGCAATAT

GTGACAGATCTCTACAAGTTCATCTCCAG GTGGATGCCATGTACACAAATGTCAAAGTGACCAACATTTGCTCTGATGGAACACTCTACTGCCAGGTGC

CCTGCAAGGGTCTGAATAAACTCAATGACCTTCTGCATAAGACAGAGGACTACTTCCACTGCAAG CACATGACCTCTGAGTACTTCATCTCGCTACCCT

TCTGTGGGAAGATCTGCCTCTTCCATTGCAAAGGGAAATGGTTACGAGTGGAG ATCACTAATGTTCATAGCAGCCGTGCACTCGACGTTCAGTTCCTGG

ACTCTGGCAATTCGACATCCGTGAAAGTGTCAGAACTCAGAGAAATCCCACCGCGGTTCCTGCAGGAAATGCTTGCCATACCCCCTCAG GCTATAAAGT

GCTGCTTGGCTGATCTTCCACAGTCCATTGGCATGTGGACACCAGATGCTGTTCTGTGGTTAAGAGATTCTGTTTTGAATTGCTCGGACTGTAGTATTAA

G GTTACAAAAATGGATGAGACCAAGGGGGTTGCCTATGTGTACTTATTCACTCCCAATAACTTCCCGGATCCCCATCGCAGTATTAACCGGCAGATCAC

AAACGCAGACCTGTGGAAACATCAGAAGGATGTGTTTCTGAGCGCGGTGTCTACTGCGGCCAGTTCCCCTGGCAACAGGAATGGTGGCACACCTGCTCCG

GGCAGCCCTGCAGAGAGTCTCAGAAAGAGCCACCCAGAGGTTATCAAGAAGTCTGTCCTGGACCATACCAGCTCTTTCTCCTTGGAGGAACTGCCCCCTC

CTGTCCACCTGTCAAGGTCAGGGGAACACATGGATGTGTATGTGCCTGTGGCCTGTCACCCAGGCCATTTTGTCATCCAGCCCTGGCAGGAGATCCATAA

GCTAGAAGTGCTGATGGAAGAGATGATCCTGTACTACAGCGTGTCCGAGGAGCGCCACATAGCGGTGGAGCGAGACCAAGTGTACGCAGCCAAAGTGGAG

AATAA GTGGTACAGGGTACTTTTAAAAGGAATCCTGACCAATGGGCTGGTGTCTGTGTACGAGCTGGACTACGGCAAGCATGAGCTCGTCAACATAAGG

AAAGTGCAGCCCCTAGTGGACGTGTTCCGAAAGCTGCCCTTCCAGGCGGTCACCGCTCAACTGGCAG GCGTGAAGTGCAGCCAGTGGTCGGAGGAGGCT

TCGATGGTGTTTCGAAATCACGTGGAGAAGAAAGCCCTGGTGGCGTTGGTGCAGACAGTTGTTGAGCACACTAATCCTTGGGACCGGAAAGTGGTGCTCT

ATCTCGTAGACACGTCGCTGCCCGACACTGACACCTGGATTCATGACTTTATGTCACAGTATCTGCTAGAGCTTTCGAAAGTTAATTAATCACTGCTTGA

GATGTTGACCGCTAATGAGATTGTTCTCAAAGCAATAATACAAAATGTGTAGGAGGGTCTTAAAACATCTTATTTTTACTACATGGCTCTGACTGTTGTG

GAGGATTGAAAAGAATATGCTTTGTTTGATGAAAGATATTTAACAAGTTTTGTTTAATGCAGTTGACTTTTCAAAGAAAAATTGCACTTGAATTATTAAT

ATAATATTAGAATAAAATGTTTAGCAAT
Translation
MRSQQSTTQRRVLSRTGPSWHPDPGLSASRT AKMLEADLVSKMLRAVLQSHKNGIVLPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVVRIEASR

SGE IVCYAVACTETARIAQLVARQRTSKRKIGRQINCQMRVKKAMPFFLEG GKPKATLRQPGFASDYSISRKPNSALLRDRGSALGVKADVDMPPYPD

TPVQRHASMSANSR RFSPKSSLPASFQTHISRACPTEVND DNLNQTVEKPNITPPASYTNKMDEVQNRIKEILDKHNNGIWISKLPHFYKEFYKEDLN

QGVLQQFEHWPHICT VEKPCGGGQDSLLYPARREQPLKSDQDPEKELPPPPPAPKQEVPSQGSPAVMPDVKEKVAELLGKYSSGLWASALPKAFEDMYK

VKFPEDALKNLASLSDVCTINYISGNTQKAILYAKLPLPTDKILKDEGQAQGDFDIKSMIEQEYLQIEKNMAESADEFLEDITVPPLVIPTEASPSVLVV

ELSNTNDVVIR RYVGKDYSAAQELMEDEMKEFYSKNPRVTPIQTVHVGQLLAVNAEEDAWLRAQIISTDENKIK VCYVDYGFCENIEKSKAYRLNPRF

CSLSFQATKCKLAG - UNI29560 - GLEVLNDDPDLVKAVESLTCGKIFAVEILDKSDVPLVVLYDTSGEDDININATCLKAICDRSLQVHLQ VDA

MYTNVKVTNICSDGTLYCQVPCKGLNKLNDLLHKTEDYFHCK HMTSEYFISLPFCGKICLFHCKGKWLRVE ITNVHSSRALDVQFLDSGNSTSVKVSE

LREIPPRFLQEMLAIPPQ AIKCCLADLPQSIGMWTPDAVLWLRDSVLNCSDCSIK VTKMDETKGVAYVYLFTPNNFPDPHRSINRQITNADLWKHQKD

VFLSAVSTAASSPGNRNGGTPAPGSPAESLRKSHPEVIKKSVLDHTSSFSLEELPPPVHLSRSGEHMDVYVPVACHPGHFVIQPWQEIHKLEVLMEEMIL

YYSVSEERHIAVERDQVYAAKVENK KWYRVLLKGILTNGLVSVYELDYGKHELVNIRKVQPLVDVFRKLPFQAVTAQLAG GVKCSQWSEEASMVFRNH

VEKKALVALVQTVVEHTNPWDRKVVLYLVDTSLPDTDTWIHDFMSQYLLELSKVN

For any suggestions or comments, please send an email to unitrap@crg.es