Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035529 (Prdm4)
Chromosomal location
Chr 10: 85354715 - 85379690 (-)
Description
PR domain containing 4 Gene [Source:MGI Symbol;Acc:MGI:1920093]
RefSeq_dna
NM_181650 
RefSeq_peptide
NP_857633.2 
UniGene
Mm.25307 Mm.408696 Mm.475332 
MGI
MGI:1920093 
Uniprot/SWISSPROT
Q80V63 
Uniprot/SPTREMBL
B2RTL4 Q3TVG3 Q8BMW8 Q8C0V8 Q8R3B9 
Human Ortholog
ENSG00000110851 (PRDM4)
Omim not available
UniTrap UNI22568
Vector Insertion
Chr 10: 85375717 - 85379268
Public Clones (sanger) E115A04 (ggtc)
Private Clones OST291496 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5827
Vector Insertion
Chr 10: 85370816 - 85372967
Public Clones CSH728 (baygenomics) CSH454 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9391
Vector Insertion
Chr 10: 85362089 - 85363586
Public Clones XH204 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037646
Sequence
CCGGGCGGGGCCGGGCGGGAAATGTTAGGAGAGCTGTAAACCGGGCGCGGGGTCCCGGGAGGCAGGAGCGTCCGGGCCGACGTTCGGCCCGATGACGAGC

CAGGCGGCCGGGCCAGTGCTCCCCAGCGCGGGCCTCAG GTCGGCCAGTCCGGCTGCCAGCGCTTCTGGGAAAACAGCCCCGGGCGCCGCCCAGCATGCC

GGGCCCTCGCCGCGGAGCGCAGCCGCCGGCCCTCGGAGACGTCGGGCAGTGCGGGGAGGCGCGGCCACCGGCGGGATGTGGTAGCACGTGACACCGGCCC

CATCGCGCACCTAGCAGCCGCCGGCCCCCTGCCCTGGACGTGCAG - UNI22568 - GATGAATGACATGAACTTGAGCCCAGTGGGGATGGAGCAGC

TGTCTTCATCCTCTGTGAGCAATGCCCTGCCAGTCTCAGGAAGTCACCTGGGCTTGGCTGCCTCTCCCTCTCACAGTGCCATCCCTGCCCCAG GACTTC

CAGTGGCAATTCCAAACCTGGGTCCCTCCCTGAGCTCTCTGCCTTCTGCCTTGTCTCTTATGCTCCCCGTGGGCATTGGAGACCGAGGAGTGATGTGTGG

GCTACCTGAGAGGAACTACACCCTACCTCCACCTCCTTACCCTCACCTAGAGAGCAGTTACTTCAGAACCATTCTACCTG - UNI5827 - GCATTTT

ATCTTATTTAGCTGACAGACCACCTCCTCAGTATATCCACCCCAACTCTATAAATGTTGATGGAAATACAGCATTATCTATCACCAACAACCCTTCAGCA

CTAGATCCGTATCAGGCCAATGGAAATGTTGGATTAGAACTAGGCATTGTTTCAATAGACTCTCGCTCTGTAAACACACATGGTGCCCAAAGTCTTCATC

CTAATGATGGCCACGAAGTAGCATTGGACACAACAATCACCATGGAGAATGTTTCTAGGGTTACCAGCCCAATCTCCACAGATGGAATGGCAGAGGAGCT

TACAATGGACGGTGTTACAGGAGAGCATCCCCAAATCCCAAATGGCTCCAGAAGTCATGAGCCTCTCTCTGTGGATTCTGTGAGCAACAGCCTTACAGCA

GAAGCTGTAGGACATGGTGGTGTGATACCCATTCACGGGAATGGTCTGGAGCTTCCTGTGGTCATGGAAACTGACCACATTGCAAACCGGGTCAATGGGA

TGTCTGACAGTACCCTCAGTGACTCCATCCACACCGTGGCCATGAGCACCAACTCTGTAAGCGTGGCACTCTCTACCTCACACAACCTGGCCTCCCTAGA

GTCTGTTTCCCTCCATGAAGTTGGCCTTAGCCTAGAGCCTGTGGCTGTCTCTTCTATCACGCAGGAGGTTGCCATGGGGACAGGTCATGTAGATGTGTCC

TCAGACAGCTTGTCTTTTGTACCATCTTCACTGCAAATGGAAGACTCCAATTCAAACAAGGAAAACATGGCAACCTTGTTTACAATTT GGTGCACTCTT

TGTGACCGAGCCTACCCCTCAGATTGCCCTGATCATGGACCAGTGACTTTTGTTCCTGACACACCAATAGAGAGCAGAGCAAGACTATCCCTCCCGAAGC

AGCTTGTTCTCCGCCAGTCCATCGTGGGAACAGATGTTG TTGGTGTCCTTCCATTGATAGGTGTATGGACTGCAGAAACCATTCCTGTGCGGACTTGCT

TCGGACCTCTAATTGGTCAGCAGAGTCACTCCTTGGAAGTAGCAGAGTGGACAGACAAGGCAGTTAACCATGTCTGGAAG ATATACCACACTGGTGTCC

TGGAGTTCTGTATCATTACAACCGATGAGAATGAGTGTAATTGGATGATGTTTGTGCGCAAAGCCAG GAACCGTGAAGAACAGAATTTGGTGGCCTATC

CCCATGATGGGAAAATCTATTTCTGTACCTCACAAGACATCCCCCCTGAAAGTGAGCTGCTTTTCTATTACAGCCGGAATTACGCTCAACAGATAG GTG

TTCCTGAACACCCAGATGTGCACCTCTGTAACTGTGGCAAGGAGTGCAGTTCCTATTCAGAGTTCAAAGCTCATCTGACCAGCCATATCCACAATCATCT

CCCTAGCCAGGGCCACAGCAGCAGCCATGGGCCAAGCCACAGCAAGGAAAGGAAGTGGAAGTGTTCAATGTGCCCCCAGGCTTTTATCTCGCCTTCCAAA

CTCCACGTTCACTTTATGGGCCACATGGGTATGAAGCCCCACAAGTGTGATTTTTGTAGCAAGGCTTTTAGTGATCCAAGCAACCTACGGACACACCTCA

AAATACATACAG - UNI9391 - GTCAGAAAAATTATAGGTGTACTTTGTGTGACAAGTCTTTCACGCAGAAGGCTCACCTGGAGTCTCACATGGTCA

TCCACACGGGTGAGAAGAATCTCAAGTGTGATTACTGTGACAAGCTGTTCATGCGGAGACAGGACCTCAAGCAGCACGTGCTCATCCACACGCA AGAAC

GCCAGATCAAGTGTCCGAAGTGTGATAAACTGTTCTTGAGAACAAACCACTTGAAGAAGCATCTCAATTCTCACGAAGGAAAACGAGATTATGTCTGCGA

AAAATGTACAAAGGCTTATCTAACCAAGTACCATCTCACTCGCCACCTGAAGACCTGCAAAGAGCCCAGCTCCAGCTCCTCTGCACAGGAGGAAGAGGAT

GATGAGTCGGAGGAAGAAGATCTCGCAGACTCCATGAGGACAGAGGACTGCAGGATGGGCAGTGCTGTTTACTCAACAGACGAGTCTCTCTCCGCACATA

AATAGGAGGAGAGAGCAACTGCTTTGGACGGAACACACATTGGTAAAACAAAACCAACCCACGGTTAGAAGTGGACGGAGTGGGGACAGCTAAAGCACTT

ACAGAGGAATGTCCAGTGGATTCTTTAAGATGGACTGGCAGATGAGGCATGCATCTGTCCTACTTTTCAGTAATGGGTGGCAATGAGAGGGCCAACTTTT

ACTATCTGTTCTTTATTTACATGTAATTTGGGAGATGTATTTATGCTTGAGTCAAAGTGCCCTTTTGTCCACACAAATCAGATTTCTCTCATATTGCTCC

ATTTTCCCCCAGCCAGCGTGACTTGAGCCATCCCACTGCATCCCACACATTAAGCACTGATGTAAGGTAACCGCCGTGCAAGTGTTAGGAGGCCTGTAAT

TAGTTAAAAAGGAACACCTGCCTACCTTCTGGCTCCTGCTGCCTCAGTCTCAGCAGGGGTTGAGAGGGCAGGTAAAGCAGCAGGCGTGGATCAGAGGACA

GTGACTGATAGAGGAAAAGGTCCAGAAGCCCACCTCTGATAGAAGCCAAGGTTAGCCACGTGGTTATGTGTATGCACATCTTTGTGATCTAGCCTTGTCT

CTTTAGGAAAGCCTTCAGTCTTTCAGAGAGGACCTAGAACATTAACAGTGTTGAGATAATACATGCTGGGTAGTCTCTAGTCAGCAAGTGCACATGGGCT

CGCCTGACGAGATCACGAGATCGGTTCTTCTGCCCACAGGAGGAAGGATCGGAATGATGGTTTGTTTTCTTTCTTTCTTTTTTGAAATGTAGGTTTACTT

TATGAAAACCATTAAAATGTTGCTAGCTGAAAGCAACAAGTAGTTCCAAATGCATTGTGGGTTTCAGTTAGGCCTTCCCAGTTGTCTTCCTTGTTGCTGA

AGGTCCTCACCAGCTGAGTGTAGAGGATACCAAAGGAATTGGAAGATGAGAAGGCTTATTAGTCACTCCCTGTGAGCAGGCACACCCAGCTTTTCTCCAG

AAGCGGACACCCTGAACTTGACAGGATTGATGGAACACGTCTTCCTGCTCAAAGGCTTGAGTAGAGGACTCTGCTGGCAAGGTTTTGCTGCTAATGTATT

TATAGAATGAATGTATTTCATTCAAACCTGTATTCCTCTAGGAAGAATTAAAATCATTTTTAATG
Translation
  - UNI22568 - MNDMNLSPVGMEQLSSSSVSNALPVSGSHLGLAASPSHSAIPAPG GLPVAIPNLGPSLSSLPSALSLMLPVGIGDRGVMCGLPE

RNYTLPPPPYPHLESSYFRTILPG - UNI5827 - GILSYLADRPPPQYIHPNSINVDGNTALSITNNPSALDPYQANGNVGLELGIVSIDSRSVNTH

GAQSLHPNDGHEVALDTTITMENVSRVTSPISTDGMAEELTMDGVTGEHPQIPNGSRSHEPLSVDSVSNSLTAEAVGHGGVIPIHGNGLELPVVMETDHI

ANRVNGMSDSTLSDSIHTVAMSTNSVSVALSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVPSSLQMEDSNSNKENMATLF

TIW WCTLCDRAYPSDCPDHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGTDVV VGVLPLIGVWTAETIPVRTCFGPLIGQQSHSLEVAEWTDKAVNH

VWK IYHTGVLEFCIITTDENECNWMMFVRKAR RNREEQNLVAYPHDGKIYFCTSQDIPPESELLFYYSRNYAQQIG GVPEHPDVHLCNCGKECSSYS

EFKAHLTSHIHNHLPSQGHSSSHGPSHSKERKWKCSMCPQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTG - UNI9391 - GQ

KNYRCTLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQ QERQIKCPKCDKLFLRTNHLKKHLNSHEGKRDYVCEKCTKAYLT

KYHLTRHLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLSAHK

For any suggestions or comments, please send an email to unitrap@crg.es