Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035545 (Leng8)
Chromosomal location
Chr 7: 4088658 - 4099775 (+)
Description
leukocyte receptor cluster (LRC) member 8 Gene [Source:MGI (curated);Acc:Leng8-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36859
Vector Insertion
Chr 7: 4088758 - 4090297
Public Clones IST14653H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117274
Sequence
AGACTAGAGCCAGCCGGTGACTGAGCGCTGTCTTGGTTGTCTTGAAGCTGCCTTGGACCGCCGGTAACGAGTCCCGGGAGCGAGCGGTCCTA - UNI36

859 - ACATTTAAAAAGCAGCCTGGCTCCCGAGGTCTATTCCCTACACCCCAAGGTCCAGATGGCGGCCAACGTGGGTGATCAGCGTGCTGCAGACTG 

GTCTTCTCAGTACAGCATGGTGACTGGGAACAGCAGAGAAAATGGCATGGAGACTCCTATGCACGAGAACCCAGAGTGGGAGAAGGCCCGCCAGGCCCTG

GCCAGCATCAGCAAAGCAGGGGCTACCAGCAGTTCCAAAGCCAGCAGCAGTGGTCCTGTGGCCAGTGCACAA TACGTCTCTCAGGCAGAAGCCTCTGCT

TTGCAGCAGCAGCAGCAACAATACTACCAGTGGTACCAGCAGTACAACTATGCCTATCCGTATAGCTACTACTACCCCATGGTGAGGACCTGGCTGCAGG

GTGGGAGCCTTCTGTCAGGGTGGGCAAATGGTTGGTTGGGGTGAAGACAGACAGCAGCCCCTGACAAAACTGCCAGATTCCTGCTTAGGTCTCATAAGAT

CTGGCATATCCATTCTGGTCCTTTCCACTGTTGATGCTGACATTTCCACTGCCTCCAGACCCCAGGACATTAGCATGTCCTAGTCCCCTATGCTTTGCTC

TCTGCAGCTCACTTCAAGGTTCCTTGCTGCCCAGCGAACACCTTCAAGAGAGCCTCCCATTGCCTTTTAAGTCGTCATCCTGCTTTTCCTTTTCTCTTCC

TTGTATTCGTTCATGGTACTTACTGGAGTACATTACCTACTTACCCCATAGCTGTGTGTAGACTTTATTAAAATCTGGGTTTTTGCTTTT
Translation
 - UNI36859 - MAANVGDQRAADW WSSQYSMVTGNSRENGMETPMHENPEWEKARQALASISKAGATSSSKASSSGPVASAQ YVSQAEASALQQQ

QQQYYQWYQQYNYAYPYSYYYPMVRTWLQGGSLLSGWANGWLG
Transcript ENSMUST00000037472
Sequence
CCCCAGACTAGAGCCAGCCGGTGACTGAGCGCTGTCTTGGTTGTCTTGAAGCTGCCTTGGACCGCCGGTAACGAGTCCCGGGAGCGAGCGGTCCTA - U

NI36859 - ACATTTAAAAAGCAGCCTGGCTCCCGAGGTCTATTCCCTACACCCCAAGGTCCAGATGGCGGCCAACGTGGGTGATCAGCGTGCTGCAGA

CTG GTCTTCTCAGTACAGCATGGTGACTGGGAACAGCAGAGAAAATGGCATGGAGACTCCTATGCACGAGAACCCAGAGTGGGAGAAGGCCCGCCAGGC

CCTGGCCAGCATCAGCAAAGCAGGGGCTACCAGCAGTTCCAAAGCCAGCAGCAGTGGTCCTGTGGCCAGTGCACAA TACGTCTCTCAGGCAGAAGCCTC

TGCTTTGCAGCAGCAGCAGCAACAATACTACCAGTGGTACCAGCAGTACAACTATGCCTATCCGTATAGCTACTACTACCCCATG AGCATGTACCAGAG

CTATGGCTCCCCCTCCCAGTATGGGATGGCCAGCTCCTACGGCTCAGCTACAGCCCAGCAGCCATCGGCTCCCCAGCACCAAGGGACTCTGAACCAG CC

TCCAGTCCCTGGCATGGATGAGAGTATGGCCTACCAGGCTTCCCCTCAGCAGCTACCTGCAGCTCAGCCCCCTCAGCCCTCAAACTCACAACATGGGACA

CATAGTCTAAGCAACGGCCCTCAGCCTGGGACAGCCCCAAGCACTCAGCACAGTCAGGCCGGGGCTCCTACAGGGCAGGCATATGGGCCACACAGCTACA

GCGAGCCTGCCAAACCTAAGAAGGGTCAGCAGTTATGGACCCGCATGAAAC CAGCCCCTGGGACTGGGGGTCTAAAATTTAACATCCAGAAGCGGCCCT

TTGCTGTCACCAGCCAGAGCTTCAGCTCCAATTCAGAGGGCCAACACAGCAGCTTTGGGCCCCAGCCCAACTCGGAGAACACTCAGAACCGCAG TGGAC

CTTCTGGCCGGGGAAACCTGTCTGGGAAGCCAGATGATTGGCCTCAGGATATGAAGGAATATGTGGAACGGTGTTTCACCGCCTGCGAGTCAGAAGAGGA

CAAGGACCGGACAGAGAAACTGCTCAAGGAGGTGCTACAGGCCCGGCTCCAGGATGGCTCTGCCTACACCATCGACTGGAGCCGAGAGCCTCTGCCTGG 

GCTGACCAGGGAGCCTGTGGCTGAGAGCCCCAAGAAGAAGCGGTGGGAGGCCCCTAGCAGCCTTCACCCTTCCAGGGGGGCAGGCTCGGTGACCAGGGGC

GGGGGTGCCCAATCCCAGCGAGGGACACCTGGGGCTGGGGGTGCTGGCCGAGCTCGGGGTAGCAGCTTCACCAAGTTCGGCAACCGCAACGTCTTCATGA

AGGATAACAGCTCTTCCTCCAGCACGGATTCACGCTCCCGCTCCTCATCCAGGTCTCCCACGAGACACTTTCGGAGAAG TGACTCCCATTCAGACTCTG

ACAGCTCCTACTCAGGGAATGAGTGCCACCCTGTAGGCCGCAGGAACCCACCCCCCAAGGGTCGGGGTGGTCGAGGGGCCCACATGGATCGAGGTCGGGG

CAGGGCGCAGCGTGGAAAGAG ACATGACCTAGCTCCCACCAAACGTAGCCGCAAGAAGATGGCAGCACTGGAGTGCGAGGACCCAGAGCGTGAGCTTAA

GAAGCAAAAGAGGGCAGCCCGCTTCCAACATGGGCACTCACGTCGCCTGCGCCTTGAACCTTTGGTGCTACAGATGAGTAACCTGGAGAGCAGTGGAGCT

GACCCTGACTGGCAGGAGCTGCAGATTGTGGGCACCTGTCCTGACATTACAAAGCACTATCTGCGGCTCACCTGCGCCCCAGACCCGTCAACTGTGCGAC

CTGTGGCT GTTTTGAAGAAGTCTCTGTGCATGGTCAAGTCCCACTGGAAGGAGAAGCAGGACTATGCCTTTGCCTGTGAGCAGATGAAGTCCATTCGGC

AGGACCTGACA GTGCAAGGCATCCGGACGGAGTTCACTGTGGAGGTGTATGAGACCCATGCCCGCATTGCCTTGGAGAAG GGTGACCATGAAGAATTC

AACCAGTGCCAAACACAGCTTAAGTCACTGTACGCGGAAAACTTAGCAGGCAATGTGGGTGAATTTACTGCATACCGAATCCTCTACTACATCTTCACCA

AGAACTCTGGAG ACATCACTACGGAACTGGCATACCTCACAAGGGAGATGAAGGCAGACCCCTGCGTGGCCCACGCGTTGGCACTGAGGGCAGCCTGGG

CCCTGGGCAACTACCACCGCTTCTTCAGGCTCTATTGCCATGCACCTTGCATGTCTGGCTACCTTGTGGACAAGTTTGCAGACCGGGAGCGCAAGGCCGC

CCTCAAGGCCATGATCAAAACGTATGTGGCACTGCACTCTGCTGCCTTCTGTGCCGTGGCTCTGCCACGTCCCCTCCGCATCCTGGTCAGCCTTCAGCTC

CTCTGCTGGAGTCCCCTCCCAGTCCCCTGTTCATAGCCCTAGCCCTCATTGCTTTCCTCATCGGCCACCTGCAGTTGCAGGTTTCCTCCCACTGTTCTGG

CCTCACCACTCCTGGCATCATGTCCTTTCCCTCCCTGCCTCCTTTCTGTTCACATCAGTTTGGAACCTGCTTTATCTTCCCCCTTCTCAGGGCCTTTGCT

TGCAGCTACGTGCTGCTCTTCTTCCTGACATACTAGAAAGGGTGACTTGATTCATATTGCTAGCAGTCTCTTGAGATGAGACCTTGTGCCCATTCCATTT

TTGACTATCAGAAGTTTTGGGTTGGGAACCTGTGGTACCAAGGCCCTTGGGCATCAGACTGCACGAGGCTTGCCCATATGAGGAGGATTCCCAACACCAC

CACAACCTTGTCCTCAGATTTTGCTCCTGGATGCTGCTGCCATCTAGTGGTAGTGGTAGAGACCAGGAACGCTGTGCAGCAAAAGGCCCCACAGCAGTGT

GTGCCAGTCTTGCCAAGGTTAAAAAATGCTGGTCAAGAGCTCTGTCGATAGTCTTGAGGAGCCTTGACTGTCAGGCTGCGCAGCAGTGTTTTGTCATTAG

TGGTTCCATTATAGTGGGATCTGCAACTTAGGGGTCAAGAAACCTGTTTGAGAATTTTCTAAGTCAGTCCAACCCAAGGGAGGTGGGGCTGTGACTCCAG

ATTGACTAGCTAAAATGAATGGACATGAGGCTACTCAGCCTTTTGTAATCCAGAAAGCCACTCTGTGGGCAGCTTTCAAGCTCTGGCCTGTGTTGGCCTC

ACTCTAACAGCACCTTTGCTGTGAGCTGAGCACAGCAGACAGATCCCTCAGATATCAGAGGCAGGCTGTTCTGTCCCAGGGCCATAGGGTGCCTGGGTTC

CAGATACTTGGTAAGGCTTAAAGTGGTCTTCAGGAGAGGGTCCTCAAAATTAGCGGTACATGTACACTATTAGGGCATCTGAGTAACAACCAGAAGGCAC

TGCTGAGTGTAACACTCTGTGCAAACATCCGGGGGGGAAGGGGGGGTAGGGGGGCGCCATTGTCCCTACCCTCTGAGCCCATGTACCACTTACTCTGTCT

GGCTCCAGCTCCTCAGTCAGCAGAGGAGCCAAGCTGGGCCCTTTCCCTCCTGCCCCCTCCTTCCTGAACAGGTAAGTGTGGGCGAGGGGGGGCACAGCTG

GGCACTGGGGCTACCAACCCCATCCCTTGCCCCCCCAAGCCCCTGAAAATGGGGAGGTCGGGAGGGGCTGCAGAAGCCAGCAGGTTCCTTGCTGAGGAAA

ATACAAGCCCAGATGGGGAGCATTGCTCCTTGTTCTTGGGCCCTCCCTTGTCTGTTTGCCTCATCATTTTCTCCTCTTGTCTCCATAGCTTCCGCCCTGC

GCTGCCCGTCTCCTACCTGCAGGCCGAGTTGGCCTTCGAGGGCGAGGCCGCCTGCCGGGCCTTCCTAGAGCCCTTGGGCCTGTCCTACACGGGCCCGGAC

AACTCCAGCGTGGACTGCCGCCTCAGCCTGGCGCAGCTGCCAGCCTTCTAAGCACCCATCGAGCACGGGCGGGAGCAGGGCTGTGGCCCAGCGCCGCCTT

TTCACATTTTTTGAGCCATGGACATGGGTTGTAAAAATTTGTGGGGAGTAGGCTCCAGGAAGAGCCAGCATCCCTGCCCCCGTTTCCCACCGGGGACCTG

TACAGAGATTTTTTTCTACATTTTTATTTTTTGTCTCAGAGGGGATAATTGGGAGTGTATAGTGGAGCAGGGTGGGGCGGGGCTACAGGTTCTGTGTGCA

CCTGTCACCTCCACTAACGCTGTCTCAGTGTTTTCTCTCTCTCTCTCGAGCTCGTAGTCCAGCGCCTGACTCTGCGTCGGCCCATCCCACGCTGGGGCCA

GCAGAAAGAAGACAGGCTGTCCAGGCCGCACCCGCTGCAGTGGGGCACCAGCCGGCCACACCCATTGCCTCGGCTGCCTCTTCATAGACTCTTGCTGCCC

AGCCGTTGGGGCCTCAGTGTTTGGGGTGAGGGAAGCCACTTAAAGACTATGCCCCACCTTCAGCTCCTCACCCCAGAAACTCCAGCCAGCACCACCGACA

CAACCAGACCAGCGCCACACCGCACTGAGGACTCCAAGGCCTTCGCGGGACCATGCCGGCCGGGCTGCCTCGTCTTACTCAAGTTGTATTAAGTTGTCTC

CGTGTCCCTTCCTCCCTCTGCCCCAATGTTTCTTCTGATTTTTTTTTTTTCTTTCCCTCCTGCCTCTTCCCTTCCCACTCCCTGGTTCAACACAGGTAAA

ATGGTTACCCTCCCTTCTTTCCTCCCCTCTGCCTTCATGGATCACCAACTCACGTCATGTTTCCTTCTCTTTTCTCTGTGTGTGTGTTTATTTAAGTTAC

TTTTCTTCCTTCTCCCCTTTTCTTTTTACCCCTCCCCCTTCTGCCATGTAACTGGAGGATGTGCTATGAGGTTGCAAACAGCTGGACTGTCAGGCTGCTT

TTTCCCAGATGCCTCCCTGCCTCCCTCCCTCCCTCTCCCCTCCCTTCCTTCATTCTCCTTGAGCATTGAGTACAGTACATTTTGGAAGCTTGAAACCAAA

ATTAAAGAGAGAGAGCGAGAA
Translation
 - UNI36859 - MAANVGDQRAADW WSSQYSMVTGNSRENGMETPMHENPEWEKARQALASISKAGATSSSKASSSGPVASAQ YVSQAEASALQQQ

QQQYYQWYQQYNYAYPYSYYYPM SMYQSYGSPSQYGMASSYGSATAQQPSAPQHQGTLNQ PPVPGMDESMAYQASPQQLPAAQPPQPSNSQHGTHSLS

NGPQPGTAPSTQHSQAGAPTGQAYGPHSYSEPAKPKKGQQLWTRMKP PAPGTGGLKFNIQKRPFAVTSQSFSSNSEGQHSSFGPQPNSENTQNRS SGP

SGRGNLSGKPDDWPQDMKEYVERCFTACESEEDKDRTEKLLKEVLQARLQDGSAYTIDWSREPLPG GLTREPVAESPKKKRWEAPSSLHPSRGAGSVTR

GGGAQSQRGTPGAGGAGRARGSSFTKFGNRNVFMKDNSSSSSTDSRSRSSSRSPTRHFRRS SDSHSDSDSSYSGNECHPVGRRNPPPKGRGGRGAHMDR

GRGRAQRGKR RHDLAPTKRSRKKMAALECEDPERELKKQKRAARFQHGHSRRLRLEPLVLQMSNLESSGADPDWQELQIVGTCPDITKHYLRLTCAPDP

STVRPVA VLKKSLCMVKSHWKEKQDYAFACEQMKSIRQDLT VQGIRTEFTVEVYETHARIALEK GDHEEFNQCQTQLKSLYAENLAGNVGEFTAYRI

LYYIFTKNSGD DITTELAYLTREMKADPCVAHALALRAAWALGNYHRFFRLYCHAPCMSGYLVDKFADRERKAALKAMIKTYVALHSAAFCAVALPRPL

RILVSLQLLCWSPLPVPCS
Transcript ENSMUST00000121270
Sequence
GAGCCAGCCGGTGACTGAGCGCTGTCTTGGTTGTCTTGAAGCTGCCTTGGACCGCCGGTAACGAGTCCCGGGAGCGAGCGGTCCTAGTGA - UNI3685

9 - ACATTTAAAAAGCAGCCTGGCTCCCGAGGTCTATTCCCTACACCCCAAGGTCCAGATGGCGGCCAACGTGGGTGATCAGCGTGCTGCAGACTG GT

CTTCTCAGTACAGCATGGTGACTGGGAACAGCAGAGAAAATGGCATGGAGACTCCTATGCACGAGAACCCAGAGTGGGAGAAGGCCCGCCAGGCCCTGGC

CAGCATCAGCAAAGCAGGGGCTACCAGCAGTTCCAAAGCCAGCAGCAGTGGTCCTGTGGCCAGTGCACAA TACGTCTCTCAGGCAGAAGCCTCTGCTTT

GCAGCAGCAGCAGCAACAATACTACCAGTGGTACCAGCAGTACAACTATGCCTATCCGTATAGCTACTACTACCCCATG AGCATGTACCAGAGCTATGG

CTCCCCCTCCCAGTATGGGATGGCCAGCTCCTACGGCTCAGCTACAGCCCAGCAGCCATCGGCTCCCCAGCACCAAGGGACTCTGAACCAG CCTCCAGT

CCCTGGCATGGATGAGAGTATGGCCTACCAGGCTTCCCCTCAGCAGCTACCTGCAGCTCAGCCCCCTCAGCCCTCAAACTCACAACATGGGACACATAGT

CTAAGCAACGGCCCTCAGCCTGGGACAGCCCCAAGCACTCAGCACAGTCAGGCCGGGGCTCCTACAGGGCAGGCATATGGGCCACACAGCTACAGCGAGC

CTGCCAAACCTAAGAAGGGTCAGCAGTTATGGACCCGCATGAAAC CAGCCCCTGGGACTGGGGGTCTAAAATTTAACATCCAGAAGCGGCCCTTTGCTG

TCACCAGCCAGAGCTTCAGCTCCAATTCAGAGGGCCAACACAGCAGCTTTGGGCCCCAGCCCAACTCGGAGAACACTCAGAACCGCAG TGGACCTTCTG

GCCGGGGAAACCTGTCTGGGAAGCCAGATGATTGGCCTCAGGATATGAAGGAATATGTGGAACGGTGTTTCACCGCCTGCGAGTCAGAAGAGGACAAGGA

CCGGACAGAGAAACTGCTCAAGGAGGTGCTACAGGCCCGGCTCCAGGATGGCTCTGCCTACACCATCGACTGGAGCCGAGAGCCTCTGCCTGG GCTGAC

CAGGGAGCCTGTGGCTGAGAGCCCCAAGAAGAAGCGGTGGGAGGCCCCTAGCAGCCTTCACCCTTCCAGGGGGGCAGGCTCGGTGACCAGGGGCGGGGGT

GCCCAATCCCAGCGAGGGACACCTGGGGCTGGGGGTGCTGGCCGAGCTCGGGGTAGCAGCTTCACCAAGTTCGGCAACCGCAACGTCTTCATGAAGGATA

ACAGCTCTTCCTCCAGCACGGATTCACGCTCCCGCTCCTCATCCAGGTCTCCCACGAGACACTTTCGGAGAAG TGACTCCCATTCAGACTCTGACAGCT

CCTACTCAGGGAATGAGTGCCACCCTGTAGGCCGCAGGAACCCACCCCCCAAGGGTCGGGGTGGTCGAGGGGCCCACATGGATCGAGGTCGGGGCAGGGC

GCAGCGTGGAAAGAG ACATGACCTAGCTCCCACCAAACGTAGCCGCAAGAAGATGGCAGCACTGGAGTGCGAGGACCCAGAGCGTGAGCTTAAGAAGCA

AAAGAGGGCAGCCCGCTTCCAACATGGGCACTCACGTCGCCTGCGCCTTGAACCTTTGGTGCTACAGATGAGTAACCTGGAGAGCAGTGGAGCTGACCCT

GACTGGCAGGAGCTGCAGATTGTGGGCACCTGTCCTGACATTACAAAGCACTATCTGCGGCTCACCTGCGCCCCAGACCCGTCAACTGTGCGACCTGTGG

CT GTTTTGAAGAAGTCTCTGTGCATGGTCAAGTCCCACTGGAAGGAGAAGCAGGACTATGCCTTTGCCTGTGAGCAGATGAAGTCCATTCGGCAGGACC

TGACA GTGCAAGGCATCCGGACGGAGTTCACTGTGGAGGTGTATGAGACCCATGCCCGCATTGCCTTGGAGAAG GGTGACCATGAAGAATTCAACCAG

TGCCAAACACAGCTTAAGTCACTGTACGCGGAAAACTTAGCAGGCAATGTGGGTGAATTTACTGCATACCGAATCCTCTACTACATCTTCACCAAGAACT

CTGGAG ACATCACTACGGAACTGGCATACCTCACAAGGGAGATGAAGGCAGACCCCTGCGTGGCCCACGCGTTGGCACTGAGGGCAGCCTGGGCCCTGG

GCAACTACCACCGCTTCTTCAGGCTCTATTGCCATGCACCTTGCATGTCTGGCTACCTTGTGGACAAGTTTGCAGACCGGGAGCGCAAGGCCGCCCTCAA

GGCCATGATCAAAAC CTTCCGCCCTGCGCTGCCCGTCTCCTACCTGCAGGCCGAGTTGGCCTTCGAGGGCGAGGCCGCCTGCCGGGCCTTCCTAGAGCC

CTTGGGCCTGTCCTACACGGGCCCGGACAACTCCAGCGTGGACTGCCGCCTCAGCCTGGCGCAGCTGCCAGCCTTCTAAGCACCCATCGAGCACGGGCGG

GAGCAGGGCTGTGGCCCAGCGCCGCCTTTTCACATTTTTTGAGCCATGGACATGGGTTGTAAAAATTTGTGGGGAGTAGGCTCCAGGAAGAGCCAGCATC

CCTGCCCCCGTTTCCCACCGGGGACCTGTACAGAGATTTTTTTCTACATTTTTATTTTTTGTCTCAGAGGGGATAATTGGGAGTGTATAGTGGAGCAGGG

TGGGGCGGGGCTACAGGTTCTGTGTGCACCTGTCACCTCCACTAACGCTGTCTCAGTGTTTTCTCTCTCTCTCTCGAGCTCGTAGTCCAGCGCCTGACTC

TGCGTCGGCCCATCCCACGCTGGGGCCAGCAGAAAGAAGACAGGCTGTCCAGGCCGCACCCGCTGCAGTGGGGCACCAGCCGGCCACACCCATTGCCTCG

GCTGCCTCTTCATAGACTCTTGCTGCCCAGCCGTTGGGGCCTCAGTGTTTGGGGTGAGGGAAGCCACTTAAAGACTATGCCCCACCTTCAGCTCCTCACC

CCAGAAACTCCAGCCAGCACCACCGACACAACCAGACCAGCGCCACACCGCACTGAGGACTCCAAGGCCTTCGCGGGACCATGCCGGCCGGGCTGCCTCG

TCTTACTCAAGTTGTATTAAGTTGTCTCCGTGTCCCTTCCTCCCTCTGCCCCAATGTTTCTTCTGATTTTTTTTTTTTCTTTCCCTCCTGCCTCTTCCCT

TCCCACTCCCTGGTTCAACACAGGTAAAATGGTTACCCTCCCTTCTTTCCTCCCCTCTGCCTTCATGGATCACCAACTCACGTCATGTTTCCTTCTCTTT

TCTCTGTGTGTGTGTTTATTTAAGTTACTTTTCTTCCTTCTCCCCTTTTCTTTTTACCCCTCCCCCTTCTGCCATGTAACTGGAGGATGTGCTATGAGGT

TGCAAACAGCTGGACTGTCAGGCTGCTTTTTCCCAGATGCCTCCCTGCCTCCCTCCCTCCCTCTCCCCTCCCTTCCTTCATTCTCCTTGAGCATTGAGTA

CAGTACATTTTGGAAGCTTGAAACCAAAATTAAAGAGAGAGAGCGAGA
Translation
 - UNI36859 - MAANVGDQRAADW WSSQYSMVTGNSRENGMETPMHENPEWEKARQALASISKAGATSSSKASSSGPVASAQ YVSQAEASALQQQ

QQQYYQWYQQYNYAYPYSYYYPM SMYQSYGSPSQYGMASSYGSATAQQPSAPQHQGTLNQ PPVPGMDESMAYQASPQQLPAAQPPQPSNSQHGTHSLS

NGPQPGTAPSTQHSQAGAPTGQAYGPHSYSEPAKPKKGQQLWTRMKP PAPGTGGLKFNIQKRPFAVTSQSFSSNSEGQHSSFGPQPNSENTQNRS SGP

SGRGNLSGKPDDWPQDMKEYVERCFTACESEEDKDRTEKLLKEVLQARLQDGSAYTIDWSREPLPG GLTREPVAESPKKKRWEAPSSLHPSRGAGSVTR

GGGAQSQRGTPGAGGAGRARGSSFTKFGNRNVFMKDNSSSSSTDSRSRSSSRSPTRHFRRS SDSHSDSDSSYSGNECHPVGRRNPPPKGRGGRGAHMDR

GRGRAQRGKR RHDLAPTKRSRKKMAALECEDPERELKKQKRAARFQHGHSRRLRLEPLVLQMSNLESSGADPDWQELQIVGTCPDITKHYLRLTCAPDP

STVRPVA VLKKSLCMVKSHWKEKQDYAFACEQMKSIRQDLT VQGIRTEFTVEVYETHARIALEK GDHEEFNQCQTQLKSLYAENLAGNVGEFTAYRI

LYYIFTKNSGD DITTELAYLTREMKADPCVAHALALRAAWALGNYHRFFRLYCHAPCMSGYLVDKFADRERKAALKAMIKT TFRPALPVSYLQAELAF

EGEAACRAFLEPLGLSYTGPDNSSVDCRLSLAQLPAF

For any suggestions or comments, please send an email to unitrap@crg.es