Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035547 (Capn5)
Chromosomal location
Chr 7: 105270076 - 105326761 (-)
Description
calpain 5 Gene [Source:MGI (curated);Acc:Capn5-001]
RefSeq_dna
NM_007602 
RefSeq_peptide
NP_031628.1 
UniGene
Mm.326847 
MGI
MGI:1100859 
Uniprot/SWISSPROT
O08688 
Uniprot/SPTREMBL
Q3TDS7 Q3TPL4 Q3U2P3 Q3UTF3 
Human Ortholog
ENSG00000149260 (CAPN5)
Omim not available
UniTrap UNI30940
Vector Insertion
Chr 7: 105310785 - 105326762
Public Clones IST13303H5 (tigm) IST13303H6 (tigm) IST12869B9 (tigm) IST13202H10 (tigm)
IST14587E7 (tigm) IST15075G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20585
Vector Insertion
Chr 7: 105310425 - 105310621
Public Clones not available
Private Clones OST357916 (lexicon) OST289226 (lexicon) OST287478 (lexicon) OST237457 (lexicon)
OST237271 (lexicon) OST226367 (lexicon) OST225677 (lexicon) OST218369 (lexicon)
OST190763 (lexicon) OST179899 (lexicon) OST169687 (lexicon) OST130377 (lexicon)
OST112071 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27809
Vector Insertion
Chr 7: 105300454 - 105310425
Public Clones not available
Private Clones OST47505 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107112
Sequence
TAGAAAGGAGAGAACCTCAGTTGCTGAGGCGGGTGCTTCACTCCGTGTCCTCTTTGCCCTATAGCAG - UNI20585 - - UNI30940 - GTGCCT

CCCCTTCTTGGGGACGTGGTCACCATGTTCTCCTGCGCGAAGGCCTATGAGGACCAGAACTACTCGGCGCTGAAGCGGGCCTGCCTGCGCAAGAAGGTGC

TGTTCGAGGATCCCCTCTTCCCTGCCACCGACGACTCCCTTTACTATAAGGGCACCCCAGGGCCCACAGTCAGGTGGAAGCGGCCTAAG - UNI20585

 - - UNI27809 - GATATCTGCGACGATCCCCGGCTCTTCGTAGATGGCATCAGCTCCCATGACCTGCACCAGGGCCAGGTGGGCAACTGCTGGTTT

GTGGCTGCCTGCTCATCACTGGCCTCCCGAGAGTCACTCTGGCAGAAG GTCATCCCAGACTGGAAGGAGCAGGAATGGAACCCCGAGAAGCCTGACAGC

TATGCTGGCATCTTCCACTTCAACTTCTGGCGCTTTGGGGAGTGGGTGGACGTAATCGTCGATGACCGGCTGCCCACAGTCAACAACCAGCTCATTTACT

GCCATTCCAACTCCAAAAATGAGTTCTGGTGTGCCCTGGTGGAGAAGGCCTATGCCAA GCTGGCCGGCTGTTACCAGGCCCTGGACGGAGGCAACACGG

CCGATGCATTGGTGGATTTCACAGGTGGTGTTTCTGAACCCATTGACCTGACCGAGGGGGACTTGGCCACTGACGAGGCTAAGAGGAATCAGCTCTTTGA

GCGAGTGCTGAAGGTGCACAGCAGAGGCGGGCTCATCAGTGCCTCCATCAAG GCTGTGACAGCAGCTGACATGGAGGCCCGCCTGGCATGTGGCCTGGT

GAAGGGCCATGCATACGCTGTCACCGATGTGCGCAAGGTGCGCCTGGGCCATGGCCTGCTGGCCTTCTTCAAGTCAGAGAAGCTTGATATGATCCGTCTG

AGGAACCCCTGGGGCGAGCGGGAGTGGACGGGGCCCTGGAGTGACAC GTCAGAGGAATGGCAGAAAGTGAGCAAGAGTGAGAGGGAGAAGATGGGCGTG

ACCGTGCAGGATGATGGGGAATTCTG GATGACCTTTGAGGACATGTGCCGGTACTTTACTGACATCATTAAATGCCGCCTGATTAACACGTCCTACCTG

AGCATCCATAAGACATGGGAGGAGGCCCGGCTGCATGGTGCCTGGACGAGACATGAGGACCCACAGCAGAACCGCAGTGGAGGCTGCATCAACCACAAGG

ACACTTTCTTCCAGAACCCACAG TACGTATTTGAAGTCAAGAAGCCAGAAGATGAAGTGTTGATCAGTATCCAGCAGCGGCCGAAGCGCTCAACTCGCC

GGGAGGGCAAAGGCGAGAATCTGGCCATTGGCTTCGACATCTATAAG GTGGAAGAGAACCGCCAATACCGTATGCACAGCCTACAGCATAAGGCCGCCA

GCTCCATCTACATCAATTCCCGCAGCGTTTTTTTGAGGACAGAGCTGCCCGAGGGCCGCTACGTTATCATCCCTACCACCTTTGAGCCAGGCCACACTGG

CGAGTTCCTGCTCCGAGTCTTCACAGATGTCCCCTCCAACTGCCG GGAACTACGCCTGGATGAGCCCCCTCGGACCTGTTGGAGTTCCCTCTGTGGCTA

CCCTCAGCAGGTGGCCCAGGTACATGTCCTGGGGGCTGCTGGCCTCAAGGACTCCCCAACAG GAGCAAACTCATATGTGATCATCAAGTGTGAGGGCGA

AAAGGTTCGCTCAGCTGTGCAGAGAGGGACCTCGACACCAGAGTACAATGTAAAAGGCATCTTCTATCGCAAGAAGCTGGCTCAGCCTATCACCGTGCAG

 GTTTGGAATCACCGAGTCCTGAAGGATGAATTCCTGGGCCAGGTGCACCTGAAGACTGCCCCGGATGACCTGCAGGACCTCCACACCCTCCATCTCCAG

GACCGCAGTAGCCGGCAGCCCAGTGACCTGCCAGGCATTGTAGCTGTGCGAGTCCTCTGCAGTGCCTCTCTCACGGCTGTCTGACCCCAGCCTGCCTGTC

CTGCCCCACTAGTCCTCACCACTACTCGCATGTCCCCACCTTGCCTGGGACCAGCCTGGGAACCAGACACTGGGGCCCTTTCCTCACTCTTCCACTGACC

CACTGTGTGACCTGAAGAGAGCCCTGCCCTCTCTGAGCCTCAGTGTTTGGAGGGCCCCAAAGAATTCCCGTCTTGTGGGGGAGTTTTCTTGCCTAA
Translation
 - UNI20585 - - UNI30940 - MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPGPTVRWKRPK - UNI20585 - - UN

I27809 - DICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQK VIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNN

QLIYCHSNSKNEFWCALVEKAYAK KLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRGGLISASIK AVTAADMEA

RLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWTGPWSDT TSEEWQKVSKSEREKMGVTVQDDGEFW WMTFEDMCRYFTDII

KCRLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQ YVFEVKKPEDEVLISIQQRPKRSTRREGKGENLAIGFDIYK VEENRQ

YRMHSLQHKAASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCR RELRLDEPPRTCWSSLCGYPQQVAQVHVLGAAGLKDSPT

G GANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQPITVQ VWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRV

LCSASLTAV
Transcript ENSMUST00000040971
Sequence
TCTGGCCTCCAATGGGAGGAGGCTGAGAGGAGGGGCGGGACAGACTGAAGCCCGGGGGTCCAAGTTCCAACCCCCGCCTGCGGGCTGCCGGGGTATCATC

TCCCCGCAGAGTCCCAGGCTGTGGCGCGGGCTGGTCTAGCCTCCGCTCCAGTGCCCGCACTGTGCTCTGCATCCCGGGAGTCCAGCTCCAGCTGCGGCGA

CGCGGCAG - UNI20585 - - UNI30940 - GTGCCTCCCCTTCTTGGGGACGTGGTCACCATGTTCTCCTGCGCGAAGGCCTATGAGGACCAGAA

CTACTCGGCGCTGAAGCGGGCCTGCCTGCGCAAGAAGGTGCTGTTCGAGGATCCCCTCTTCCCTGCCACCGACGACTCCCTTTACTATAAGGGCACCCCA

GGGCCCACAGTCAGGTGGAAGCGGCCTAAG - UNI20585 - - UNI27809 - GATATCTGCGACGATCCCCGGCTCTTCGTAGATGGCATCAGCT

CCCATGACCTGCACCAGGGCCAGGTGGGCAACTGCTGGTTTGTGGCTGCCTGCTCATCACTGGCCTCCCGAGAGTCACTCTGGCAGAAG GTCATCCCAG

ACTGGAAGGAGCAGGAATGGAACCCCGAGAAGCCTGACAGCTATGCTGGCATCTTCCACTTCAACTTCTGGCGCTTTGGGGAGTGGGTGGACGTAATCGT

CGATGACCGGCTGCCCACAGTCAACAACCAGCTCATTTACTGCCATTCCAACTCCAAAAATGAGTTCTGGTGTGCCCTGGTGGAGAAGGCCTATGCCAA 

GCTGGCCGGCTGTTACCAGGCCCTGGACGGAGGCAACACGGCCGATGCATTGGTGGATTTCACAGGTGGTGTTTCTGAACCCATTGACCTGACCGAGGGG

GACTTGGCCACTGACGAGGCTAAGAGGAATCAGCTCTTTGAGCGAGTGCTGAAGGTGCACAGCAGAGGCGGGCTCATCAGTGCCTCCATCAAG GCTGTG

ACAGCAGCTGACATGGAGGCCCGCCTGGCATGTGGCCTGGTGAAGGGCCATGCATACGCTGTCACCGATGTGCGCAAGGTGCGCCTGGGCCATGGCCTGC

TGGCCTTCTTCAAGTCAGAGAAGCTTGATATGATCCGTCTGAGGAACCCCTGGGGCGAGCGGGAGTGGACGGGGCCCTGGAGTGACAC GTCAGAGGAAT

GGCAGAAAGTGAGCAAGAGTGAGAGGGAGAAGATGGGCGTGACCGTGCAGGATGATGGGGAATTCTG GATGACCTTTGAGGACATGTGCCGGTACTTTA

CTGACATCATTAAATGCCGCCTGATTAACACGTCCTACCTGAGCATCCATAAGACATGGGAGGAGGCCCGGCTGCATGGTGCCTGGACGAGACATGAGGA

CCCACAGCAGAACCGCAGTGGAGGCTGCATCAACCACAAGGACACTTTCTTCCAGAACCCACAG TACGTATTTGAAGTCAAGAAGCCAGAAGATGAAGT

GTTGATCAGTATCCAGCAGCGGCCGAAGCGCTCAACTCGCCGGGAGGGCAAAGGCGAGAATCTGGCCATTGGCTTCGACATCTATAAG GTGGAAGAGAA

CCGCCAATACCGTATGCACAGCCTACAGCATAAGGCCGCCAGCTCCATCTACATCAATTCCCGCAGCGTTTTTTTGAGGACAGAGCTGCCCGAGGGCCGC

TACGTTATCATCCCTACCACCTTTGAGCCAGGCCACACTGGCGAGTTCCTGCTCCGAGTCTTCACAGATGTCCCCTCCAACTGCCG GGAACTACGCCTG

GATGAGCCCCCTCGGACCTGTTGGAGTTCCCTCTGTGGCTACCCTCAGCAGGTGGCCCAGGTACATGTCCTGGGGGCTGCTGGCCTCAAGGACTCCCCAA

CAG GAGCAAACTCATATGTGATCATCAAGTGTGAGGGCGAAAAGGTTCGCTCAGCTGTGCAGAGAGGGACCTCGACACCAGAGTACAATGTAAAAGGCA

TCTTCTATCGCAAGAAGCTGGCTCAGCCTATCACCGTGCAG GTTTGGAATCACCGAGTCCTGAAGGATGAATTCCTGGGCCAGGTGCACCTGAAGACTG

CCCCGGATGACCTGCAGGACCTCCACACCCTCCATCTCCAGGACCGCAGTAGCCGGCAGCCCAGTGACCTGCCAGGCATTGTAGCTGTGCGAGTCCTCTG

CAGTGCCTCTCTCACGGCTGTCTGACCCCAGCCTGCCTGTCCTGCCCCACTAGTCCTCACCACTACTCGCATGTCCCCACCTTGCCTGGGACCAGCCTGG

GAACCAGACACTGGGGCCCTTTCCTCACTCTTCCACTGACCCACTGTGTGACCTGAAGAGAGCCCTGCCCTCTCTGAGCCTCAGTGTTTGGAGGGCCCCA

AAGAATTCCCGTCTTGTGGGGGAGTTTTCTTGCCTAAGATTTAATGCAGTTCTCTCTACCCAGTGGGCGCTGCTGTTAAGGGGCCATCTGCTGAAAACGT

TTCCCCAGGCCCTGCTGTCTGCCAGGAGTGCCAAGTGTCAACTGTTTACACACAAACTGCCATGTCCCACGCCCCTTCCCTCTCCTTGTTTGCTATGGGG

GAGATTGCTTCCCTCCCCAGATCTTTGCTATGTAGCTTAGAGTGACCTTAAACTTATGATCCCCCTGCCTCCACCTCCTCAATGCCGTACCACTATACCA

GTTTGAGTGGTGCTGGGTATGGAACCCAGGGCTTTGTGCATGCTAGGCGAGCACTTACCAACTGAGCTACATCCCCAATCCCACTACAGCCCATTTTAAA

ACCATCTTGAAAGAACCCTTATTGGCATATGCAGGAGACATCTGCTCATTGTCTAATGCCTGACCCCCATTCATTTAGTTATTCAATATAGACTTGCCCA

ATTAGCCCATCGAGCCTCCCTAGGCTTCCCGATTCTCAGGTCTTCTCGGAGGCAGATCCCTTCCTGAGCTCCAGGCTCTGACTTCACCGTCACCCTCTGA

AGAGCTATGATCATGCTGGTGAGAAAGTATGATTTCCCAACCTCTGCTTGTGGTGTTGGAAGGAGTGGCCTGGCCAGGCAGGTTGATGTAAGGCTATGGG

AGACCCAAGGGGAACACATGCTGCCTCTGCTGAAAGACCCTGGGTTTTTCTTGGAAGAAAGGACTCTAGGGTGGATGGTACCAGGCCTTCAGGGTTAGAT

CATCTGTCAAGTGTCACCGATGGGGACTTCTCATGACCAGAGGGCTCTGCACCAGCATCCCCAAAGAGCCAAGAAGGCCACCATGCTTTTACTGTCCAGA

CCAAAATGTTGCTCTCAATCCCCAACATTTGATAGTCTTAGCATTTAAACAAAATCTCCGAGTGAGGGAGGCCAGCCCCCACATTTGTCCTCTGCAGGCT

CATTTTGTTGAGCGTCTGCTTTTATCTTGACACTGAGCACGAGAGGGCACGGGTGGGTGCTCACAGTGGGACCTTCTTGGAGGAATCTCAGAGGGGGACA

GAGATGAGATGTGCATTCCTGGCTGCCACCTGCATTCCTGAGGAACTCTTGTTTACTGGTGCTGTGGCTCACAGGTCCCCCTCTGTGCCCTCCTTCAGCT

TCCAGGCCAGACTTAGTAGATAAATAGTAATAATAATAATAATACAATTGAGTTATCAGCCACAATTCCTTTTGGAACTGTTACACTCTGCCTCTGGTCC

CTCCAACGTGGTCCTCTTCCTGGCTGGAGGTGCTGGATTCTGACTGCCATCTTGCTCCATGGTGGCTCTTCTGGCCTGGGACCCGGTCCACAGGAAGGGC

TAGGAGCTGAATTAAAGATGAGAGCATCCCTCCTGCACACTGGGGCTTCCCTTCACCAGGAGCAAATCACTTCAACCTCCCGTGCCTCGTTTCCTCCCTC

TGTAGCATGGGGCTCGAGACTCCTGTTTGTGAGGGACTCTTACAAGGATAAGAGCAAGGCCACACCACTTCCGCTGTGTATCAGTCTATCATACACTCCG

CACGGTCACATGATCACTTCACTTCTCGATGGCTATTGCAGACCAAGACTGCAGTCAAGAAGGGAGGGTGAGCCTCACGATCTTGGGTCTCAGGGCCTGA

CATAGGGGTCTTAGCTCAGCCATATCCCTCTGAGGCACAGGGCGAGCAGGGACCAAGTAGCAGACGAGTCGATGCTTCACCTGGCATCTAGCCACTGCCT

CCCACTTCTAGCAGAACTGGGTCAGCAGCCCTGTTCTTGCTTCCTCTCTCTTAAGCTAGGCCAGGCTGGCTCCTGGCTGTGAAGGAACTTCCGGTCCCCA

AGAAGCCTTGAAGACTGGACAAGGGAGGACAGGGTGGAGCAGGGATAGCCGTGGCTTCATTTATCGTTTGCACCCAGGAGGCCTTGTAGTCTTCCAATTG

CAGGAGATCAGCCCTACAGTGTATTCTACGTGAACCAACAGGGCCTGGCCTTCACTCCTCCAGGCCACAATGCCCTGGGGTCAAGGGAAAGGAACTCTGT

TATCTTCTCAGAATAAATATTACTGCCGCTCT
Translation
 - UNI20585 - - UNI30940 - MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPGPTVRWKRPK - UNI20585 - - UN

I27809 - DICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQK VIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNN

QLIYCHSNSKNEFWCALVEKAYAK KLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRGGLISASIK AVTAADMEA

RLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWTGPWSDT TSEEWQKVSKSEREKMGVTVQDDGEFW WMTFEDMCRYFTDII

KCRLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQ YVFEVKKPEDEVLISIQQRPKRSTRREGKGENLAIGFDIYK VEENRQ

YRMHSLQHKAASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCR RELRLDEPPRTCWSSLCGYPQQVAQVHVLGAAGLKDSPT

G GANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQPITVQ VWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRV

LCSASLTAV

For any suggestions or comments, please send an email to unitrap@crg.es