Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035596 (Leng4)
Chromosomal location
Chr 7: 3629392 - 3644650 (-)
Description
membrane bound O-acyltransferase domain containing 7 Gene [Source:MGI (curated);Acc:Leng4-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36681
Vector Insertion
Chr 7: 3637275 - 3640285
Public Clones IST12103G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118710
Sequence
CGGGACTCGAAGATCTTGGCCCCGCCTCTCTGACCCGAAACCCCGCCCCTTCACGTACTGGCAGCTCTTTGCCCGGGGACCTCCTAGAAAGATCGCGACA

GGCATCTTGCGGCAGACTGGTGTTCTGGGTACCTTTCTTGCGGTGCTGTAACTCGTACAGCCGCGGCTCTCGGGGCCTGGACCGCGCAGCCCTGCCGGCG

CCCTCCAGAACGGGCAGTGCGGGGGCGTGCTGAGCTGGGGAGGCGTGGCGCGAGCCGAGGCGGCCTCGAAAAGGAGCTCCGCAGTCTTCTGGCCCACGGA

CGGTTCAG ACCATGACACCCGAAGAATGGACATATCTAATGGTCCTTCTTATCTCCATCCCTGTTGGCTTCCTCTTTAAGAAAGCTG GACCTGGGCTG

AAGAGATGGGGGGCAGCAGCTGTGGGCCTGGGGCTCACCTTATTCACCTGTGGCCCCCACAGTTTGCATTCTCTGATCACCATCTTGGGAACCTGGGCCC

TCATTCAGGCCCAGCCCTG CTCCTGCCATGCCCTGGCTCTTGCCTGGACCTTCTCCTATCTCCTCTTCTTCCGAGCCCTCAGCCTGCTGGGCCTGCCCA

CTCCCACGCCCTTCACCAATGCTGTCCAGCTGCTGTTGACACTGAAG - UNI36681 - TTGGTGAGTCTAGCTAGTGAAGTCCAGGATCTGCATCTG

GCTCAGAGAAAGGAAATAGCCTCCGGCTTCCACAAGGAGCCTACGCTGGGCCTCCTGCCTGAGGTCCCCTCTTTGATGGAGACACTCAGCTATAGCTACT

GTTACGTGGGAATCATGACAG - UNI36681 - GCCCATTCTTCCGCTACCGCACCTACCTGGATTGGCTGGAACAGCCCTTCCCGGAAGCCGTGCCC

AGCCTGAGGCCCCTGCTGCGCCGCGCCTGGCCAGCCCCGCTCTTTGGCCTGCTCTTCCTGCTGTCCTCCCATCTCTTCCCACTGGAAGCTGTGCGTGAGG

ACGCCTTCTACGCCCGCCCGCTGCCCACCCGCCTCTTCTACATGATCCCGGTCTTCTTCGCCTTCCGCATGCGCTTCTACGTTGCCTGGATTGCGGCCGA

GTGCGGTTGCATTGCCGCGGGCTTCGGGGCCTACCCTGTGGCTGCCAAAGCCCGGGCCGGGGGCGGCCCCACCCTCCAATGCCCACCCCCTAGCAG - U

NI36681 - TCCGGAGATTGCAGCTTCCCTGGAGTATGACTATGAGACCATCCGTAACATCGACTGCTATGGCACAGACTTCTGCGTGCGTGTGCGGGA

TGGCATGCGATACTGGAACATGACCGTGCAGTGGTGGCTGGCACAGTACATCTACAAGAGCGCACCTTTCCGCTCCTACGTTTTGAGGTGAGGGAGCCCA

CCTGGTATCAGAGACAGTGCAGAACTTTATCTGCCAGTATGACTGACCTGTGGTAGTCTGGGGCTTCTCTAGCTGGGCCCTAAGGCCCAAGGCTTATGGA

AATTGTAGTTTCTTGGGCC
Translation
 MTPEEWTYLMVLLISIPVGFLFKKAG GPGLKRWGAAAVGLGLTLFTCGPHSLHSLITILGTWALIQAQPC CSCHALALAWTFSYLLFFRALSLLGLP

TPTPFTNAVQLLLTLK - UNI36681 - LVSLASEVQDLHLAQRKEIASGFHKEPTLGLLPEVPSLMETLSYSYCYVGIMTG - UNI36681 - GP

FFRYRTYLDWLEQPFPEAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPTRLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPV

AAKARAGGGPTLQCPPPSS - UNI36681 - SPEIAASLEYDYETIRNIDCYGTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPFRSYVLR
Transcript ENSMUST00000038608
Sequence
GGGACCTCCTAGAAAGATCGCGACAGGCATCTTGCGGCAGACTGGTGTTCTGGGTACCTTTCTTGCGGTGCTGTAACTCGTACAGCCGCGGCTCTCGGGG

CCTGGACCGCGCAGCCCTGCCGGCGCCCTCCAGAACGGGCAGTGCGGGGGCGTGCTGAGCTGGGGAGGCGTGGCGCGAGCCGAGGCGGCCTCGAAAAGGA

GCTCCGCAGTCTTCTGGCCCACGGACGGTTCAG ACCATGACACCCGAAGAATGGACATATCTAATGGTCCTTCTTATCTCCATCCCTGTTGGCTTCCTC

TTTAAGAAAGCTG GACCTGGGCTGAAGAGATGGGGGGCAGCAGCTGTGGGCCTGGGGCTCACCTTATTCACCTGTGGCCCCCACAGTTTGCATTCTCTG

ATCACCATCTTGGGAACCTGGGCCCTCATTCAGGCCCAGCCCTG CTCCTGCCATGCCCTGGCTCTTGCCTGGACCTTCTCCTATCTCCTCTTCTTCCGA

GCCCTCAGCCTGCTGGGCCTGCCCACTCCCACGCCCTTCACCAATGCTGTCCAGCTGCTGTTGACACTGAAG - UNI36681 - TTGGTGAGTCTAGC

TAGTGAAGTCCAGGATCTGCATCTGGCTCAGAGAAAGGAAATAGCCTCCGGCTTCCACAAGGAGCCTACGCTGGGCCTCCTGCCTGAGGTCCCCTCTTTG

ATGGAGACACTCAGCTATAGCTACTGTTACGTGGGAATCATGACAG - UNI36681 - GCCCATTCTTCCGCTACCGCACCTACCTGGATTGGCTGGA

ACAGCCCTTCCCGGAAGCCGTGCCCAGCCTGAGGCCCCTGCTGCGCCGCGCCTGGCCAGCCCCGCTCTTTGGCCTGCTCTTCCTGCTGTCCTCCCATCTC

TTCCCACTGGAAGCTGTGCGTGAGGACGCCTTCTACGCCCGCCCGCTGCCCACCCGCCTCTTCTACATGATCCCGGTCTTCTTCGCCTTCCGCATGCGCT

TCTACGTTGCCTGGATTGCGGCCGAGTGCGGTTGCATTGCCGCGGGCTTCGGGGCCTACCCTGTGGCTGCCAAAGCCCGGGCCGGGGGCGGCCCCACCCT

CCAATGCCCACCCCCTAGCAG - UNI36681 - TCCGGAGATTGCAGCTTCCCTGGAGTATGACTATGAGACCATCCGTAACATCGACTGCTATGGCA

CAGACTTCTGCGTGCGTGTGCGGGATGGCATGCGATACTGGAACATGACCGTGCAGTGGTGGCTGGCACAGTACATCTACAAGAGCGCACCTTTCCGCTC

CTACGTTTTGAG GAGTGCCTGGACCATGCTGTTGAGTGCCTACTGGCATGGCCTCCACCCTGGTTACTACCTAAGCTTCATGACCATCCCGCTGTGCCT

GGCTGCTGAGGGCTATTTGGAGTCAGCCTTGCGGAGACACCTGAGCCCCGGGGGCCAGAAAGCCTGGGACTGGGTCCACTGGTTCCTGAAGATGCGTGCC

TACGACTACATGTGCATGGGCTTTGTGCTCCTTTCCATGGCTGACACACTCCGGTACTGGGCCTCCATCTACTTCTGGGTCCACTTTCTAGCCCTGGCTT

GCTTGGGGCTGGGGCTGGTTTTGGGTGGGGGCAGCCCCAGCAAGAGGAAGACACCATCCCAGGCCACCAGCAGCCAAGCGAAGGAAAAGCTCCGGGAAGA

GTGAGCTCTGCTGCATTGGCCTGCCTTCCAGTTCAAGCTTTTTTGGGAATTCCATGAACCAGGCTGTTTGTTTGGGGTTTTTGTTTGTTTGTTTGTTTGT

TTCCTTTACCCAGCAAGAATCCCTTGTTTGGCTAAGAGCCTGGAGAGGATCCCCTCTTCCCAAATAATTCCTCTGCCTTCTATTTAAAGCTAAGGTATCC

TTCTCTTGGGCTCTCTCAGCATCTTGACCTTTTCAGACCTTCCTCTGCTAACATCAGGGTATTACTATCCACTCTTGAACCTATTATCTCTGCAACAATC

TTCAGATGTTCAAAAAGCCACACTTCCCAAAAATGCCCTTGCAGGGACCAGTGGTCATCTGGCATCTTAGACAGACTCCCAGTGGGTCCCCAGTATGGGG

GCAGGAACTTCAGGGCCAGGTTCTGGGAGAGGGGAGGGATAGCCTTCTTGTTTTCCTCTTTGTTTTTATCATCACACCAGTGTTTCAGAGACCATGGTCT

TACACATGCTGAAGGAGAAGCTAAAATGTGAGAAGCCCCAGGGGAGCTTGCTCTTACAGCAGCTTCTGCCTGAGCCATTTCTGGGCTCCCCATACAACCT

ACCACCCAGTGTCATCCTTGGCCTGTGACAGGCCAGAATGTATAAAGCTTTCCCAATAAAGTGTTACACATGC
Translation
 MTPEEWTYLMVLLISIPVGFLFKKAG GPGLKRWGAAAVGLGLTLFTCGPHSLHSLITILGTWALIQAQPC CSCHALALAWTFSYLLFFRALSLLGLP

TPTPFTNAVQLLLTLK - UNI36681 - LVSLASEVQDLHLAQRKEIASGFHKEPTLGLLPEVPSLMETLSYSYCYVGIMTG - UNI36681 - GP

FFRYRTYLDWLEQPFPEAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPTRLFYMIPVFFAFRMRFYVAWIAAECGCIAAGFGAYPV

AAKARAGGGPTLQCPPPSS - UNI36681 - SPEIAASLEYDYETIRNIDCYGTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPFRSYVLR RSAWTM

LLSAYWHGLHPGYYLSFMTIPLCLAAEGYLESALRRHLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSMADTLRYWASIYFWVHFLALACLGLGLVLGG

GSPSKRKTPSQATSSQAKEKLREE

For any suggestions or comments, please send an email to unitrap@crg.es