Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035601 (Rg9mtd3)
Chromosomal location
Chr 4: 45310040 - 45329003 (+)
Description
RNA (guanine-9-) methyltransferase domain containing 3 Gene [Source:MGI (curated);Acc:Rg9mtd3-001]
RefSeq_dna
NM_027266 
RefSeq_peptide
NP_081542.2 
UniGene
Mm.46761 
MGI
MGI:1917184 
Uniprot/SWISSPROT
Q9D075 
Human Ortholog
ENSG00000165275 (RG9MTD3)
Omim not available
UniTrap UNI23916
Vector Insertion
Chr 4: 45317261 - 45318615
Public Clones not available
Private Clones OST240540 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5100
Vector Insertion
Chr 4: 45320843 - 45321368
Public Clones YTC719 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13881
Vector Insertion
Chr 4: 45327279 - 45327883
Public Clones CMHD-GT_213B4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107800
Sequence
GACGTCAGCGCATGGACTGTAAGTCGGAAGAGAGCGCCCAGAGAACAGACTCACAGGCCTTTCAGGAACCAGACGGACTCCCAGAGGCCGGAGGTGAAGA

TGGACTCTCTGAAAGCTTCCAGCTTCTGCAGGTGGATGTGGAGTACGAGCGCCCAGAAGAGACCAGCCCTGCAAACAGTGCCGTGTGGAGCTCG AAAAA

CATGCAAAGAAAACAGAGACACTGGGAAAGGATAGTCTCCTCAAAGAAGAGCAAAAGGAAGCAGGAAAGAGAACGAAGGAAAGCCAAGCGTGCAGAAGAC

CCCG GCACCTGCCCACAGCACAGCAAACGCTTTTTGAAAGCCTTAACCAAAGAGAAACTTTTGGAAGCCAAACACTCAGGACCAAGACTATGTGTTGAC

TTGAGCATGACCCAGCACATGTCAAAGAAG - UNI23916 - GAATTGAGTAGGTTGGCGGGACAGATTCGAAGGTTGTATGGTTCGAACAAAAAAGC

CAGCAGGCCCTTTTGGATCTGCCTTACTGGATTCTCAACTGCCAGCCCCCTCTATGAGGAGTGTCTGAGGATGAACGACGGGTTTTCTGCTTACTTG CT

GGATGTGACAGAAGAAGACTGCTTTAGCCTTTTTCCTCTGGAAACCCTTGTGTACCTGACTCCTGACTCCGAACACT - UNI5100 - CCCTTGAAGA

CATTGATCAGAGCACAGTTTACGTTATTGGTGGACTTGTAGATGAGAGCATTCAGAAG AAGGTGACATTTCAAAAAGCCCGAGAATACTCTGTCAAGAC

AGCCCGCTTGCCAATCCAGGAATACATGATCAAGCGCCAGAATGAGAAAAACTACCATTCGGAAATATTGGCCATCAACCAAG - UNI13881 - TGT

TCGATATCCTGTCTACTTACTTTGAAACTCGTAACTGGCCTGAAGCACTGAAGAAAGGAGTTTCTCCAGGAAAAGGCTACGTTCTTCAGAATTCAGCAGA

AGGATGAGCAGCCTAAGATTCCAGCTGC
Translation
MDCKSEESAQRTDSQAFQEPDGLPEAGGEDGLSESFQLLQVDVEYERPEETSPANSAVWSS KNMQRKQRHWERIVSSKKSKRKQERERRKAKRAEDPG 

GTCPQHSKRFLKALTKEKLLEAKHSGPRLCVDLSMTQHMSKK - UNI23916 - ELSRLAGQIRRLYGSNKKASRPFWICLTGFSTASPLYEECLRMN

DGFSAYL LDVTEEDCFSLFPLETLVYLTPDSEHS - UNI5100 - SLEDIDQSTVYVIGGLVDESIQK KVTFQKAREYSVKTARLPIQEYMIKRQN

EKNYHSEILAINQV - UNI13881 - VFDILSTYFETRNWPEALKKGVSPGKGYVLQNSAEG
Transcript ENSMUST00000044673
Sequence
GTGTTCTCTTCTGAGCAAGGTGTGTTAG GAATCAGCTGTGTAAGTGACGTCAGCGCATGGACTGTAAGTCGGAAGAGAGCGCCCAGAGAACAGACTCAC

AGGCCTTTCAGGAACCAGACGGACTCCCAGAGGCCGGAGGTGAAGATGGACTCTCTGAAAGCTTCCAGCTTCTGCAGGTGGATGTGGAGTACGAGCGCCC

AGAAGAGACCAGCCCTGCAAACAGTGCCGTGTGGAGCTCG AAAAACATGCAAAGAAAACAGAGACACTGGGAAAGGATAGTCTCCTCAAAGAAGAGCAA

AAGGAAGCAGGAAAGAGAACGAAGGAAAGCCAAGCGTGCAGAAGACCCCGGTAACG GCACCTGCCCACAGCACAGCAAACGCTTTTTGAAAGCCTTAAC

CAAAGAGAAACTTTTGGAAGCCAAACACTCAGGACCAAGACTATGTGTTGACTTGAGCATGACCCAGCACATGTCAAAGAAG - UNI23916 - GAAT

TGAGTAGGTTGGCGGGACAGATTCGAAGGTTGTATGGTTCGAACAAAAAAGCCAGCAGGCCCTTTTGGATCTGCCTTACTGGATTCTCAACTGCCAGCCC

CCTCTATGAGGAGTGTCTGAGGATGAACGACGGGTTTTCTGCTTACTTG CTGGATGTGACAGAAGAAGACTGCTTTAGCCTTTTTCCTCTGGAAACCCT

TGTGTACCTGACTCCTGACTCCGAACACT - UNI5100 - CCCTTGAAGACATTGATCAGAGCACAGTTTACGTTATTGGTGGACTTGTAGATGAGAG

CATTCAGAAG AAGGTGACATTTCAAAAAGCCCGAGAATACTCTGTCAAGACAGCCCGCTTGCCAATCCAGGAATACATGATCAAGCGCCAGAATGAGAA

AAACTACCATTCGGAAATATTGGCCATCAACCAAG - UNI13881 - TGTTCGATATCCTGTCTACTTACTTTGAAACTCGTAACTGGCCTGAAGCAC

TGAAGAAAGGAGTTTCTCCAGGAAAAGGCTACGTTCTTCAGAATTCAGCAGAAGGATGAGCAGCCTAAGATTCCAGCTGCAGGGGGTGAAGTGCCAGAGG

TGTCTTGACCAAAGGACCAGGCAAAGTGTGGCAATGGCACACACTTGCCTCTACATGCTATCTCGGATCTTTGAAAGCCATTAGTGGCAAGGACCACATT

TTATGTTGTCACCCACAATGCCTAACTCACTGAAAATGCCCTGATAAAACATATTATGGTTTAAAAAAAAAGCTTGTGTTAAGTAATTGCCAAAATACAT

GTCATTCTGGGTGTTAATTCATGCTTTGTACATTCATCTGTTTGTGAAAGGTCTACTTTTAAAGTTGTTTAAATGATTGTCTGAACTTTTCATTTAACTT

ACATAAAATTATTTTTGTCACCTGAAATGTGCCGATTTCCACCAGCTCAGACATATGCTGCAACAAGCTCTGCTGTCCTAGCCCCGCCTGGCCCGCACTA

CTTTACGTTTAGAGTACTTGGTTCTTTCCTGTGGCTCTCACCCTGTTCTTGTTCTGACTATAGTCATGGAGGGCTCCTCTCCTCTAGTCTTTGTAAATAG

CTTTGTGTAGCCTTGAGCTTAGACAAGCCAAGTGCTCTGGACAAATATATACCCCAAGTTAATAAAAACAAAAGTAATTATTGATAAATCCAACATAAAG

CAGCCAAAAAAGGTTGCTGCATTCTGACAGAGAAGCATACTGATCCACCTTCTGTGTTACTCTTATTGCAGGATAGGCAAGGCCTCAGGGAAGCCCTTTA

AGGGACTGGGCCACATAGGCTTCAGGGGTCCATAACTCATTCTCAGAGGTCTGACTGAACTGAGAACCCCTCAGCTCTTACCACCTGCCAGCCTACACTT

TTCCCTGTGGAGGTTTTACCATAACGTAGATAGCACAGAATCTTCCTCCAACTCTAAACACTCCTCTTTATCCAAAACCTGAGCTCGTAGGTTTTTAAGA

TTGTGGGAATTCTGTTAAATGATGTTTAGCCAGCCTTGGATTAAAAATCTTCATCATACTATTACATCT
Translation
 MDCKSEESAQRTDSQAFQEPDGLPEAGGEDGLSESFQLLQVDVEYERPEETSPANSAVWSS KNMQRKQRHWERIVSSKKSKRKQERERRKAKRAEDPG

NG GTCPQHSKRFLKALTKEKLLEAKHSGPRLCVDLSMTQHMSKK - UNI23916 - ELSRLAGQIRRLYGSNKKASRPFWICLTGFSTASPLYEECL

RMNDGFSAYL LDVTEEDCFSLFPLETLVYLTPDSEHS - UNI5100 - SLEDIDQSTVYVIGGLVDESIQK KVTFQKAREYSVKTARLPIQEYMIK

RQNEKNYHSEILAINQV - UNI13881 - VFDILSTYFETRNWPEALKKGVSPGKGYVLQNSAEG

For any suggestions or comments, please send an email to unitrap@crg.es