Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035637 (Grhpr)
Chromosomal location
Chr 4: 44994288 - 45003573 (+)
Description
glyoxylate reductase/hydroxypyruvate reductase Gene [Source:MGI (curated);Acc:Grhpr-001]
RefSeq_dna
NM_080289 
RefSeq_peptide
NP_525028.1 
UniGene
Mm.196574 
MGI
MGI:1923488 
Uniprot/SWISSPROT
Q91Z53 
Uniprot/SPTREMBL
B1AXQ0 Q3T9Z2 
Human Ortholog
ENSG00000137106 (GRHPR)
Omim 260000 - HYPEROXALURIA, PRIMARY, TYPE II  
UniTrap UNI19707
Vector Insertion
Chr 4: 44994407 - 44995750
Public Clones not available
Private Clones OST383093 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107819
Sequence
ATGAAACCGGCGCGACTCATGAAGGTGTTCGTCACTGGCCCGTTGCCTGCCGAG - UNI19707 - GGAGCCAACCTCAGAGTCATCAGCACCTTGTC

TGTGGGGGTCGACCACTTGGCTTTGGATGAAATCAAGAAGCG CGGGATCCGGGTGGGCTACACGCCAGGTGTCCTGACAGATGCCACTGCAGAACTCGC

CGTCTCCCTCCTCCTCACCACCTGCCGCCGGTTGCCGGAGGCCATAGAGGAAGTGAAGAA CGGCGGCTGGAGCTCCTGGAGCCCATTATGGATGTGCGG

CTACGGACTCTCGCAGAGCACTGTTGGCATTGTGGGGCTGGGGCGCATAG GTCAGGCCATCGCTCGACGACTGAAACCATTCGGTGTCCAGAGATTTCT

TTACACGGGGCGCCAGCCCAGGCCTCAGGAAGCAGCCGAGTTTCAGGCAGAGTTTG TGCCTATTGCTCAGCTGGCCGCAGAGTCAGACTTCATTGTCGT

GTCCTGCTCCTTAACACCCGATACCATGGGGCTCTGCAGCAAGGATTTCTTCCAGAAGATGAAGAACACAGCTATCTTCATCAACATCAGCAG AGGAGA

TGTGGTAAACCAGGAAGACCTGTACCAGGCACTAGCCAGTGGTCAGATTGCAGCAGCGGGACTGGATGTGACCACCCCTGAACCACTGCCTCCGAGCCAC

CCCCTGCTGACCCTCAAGAACTGCG TGATCCTGCCCCACATTGGCAGTGCCACCTACAAAACTCGCAACACCATGTCCTTGCTGGCGGCTAACAACTTG

CTGGCTGGCCTAAGAGGGGAGGCCATGCCCAGCGAACTCAAGCTGTAACCAGATGGGCTTTCATGGGCTGGAGACATCTTGCCAGACAGAGCCAAGCTGG

ACTTCGGACTTTGGTGAGAGCCTGGGGCAGGCCTCCTCTACTGCATTTTCAGGGGACCTGGAAATGGGCAGATGGGCTTGCCACTTTGGGGGCTTGCCAC

ATACTTGCCAAAAGCCTGTAATTCTAGCATTAAACAACTTCTGACACAGTG
Translation
MKPARLMKVFVTGPLPAE - UNI19707 - GANLRVISTLSVGVDHLALDEIKKR RGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKN N

GGWSSWSPLWMCGYGLSQSTVGIVGLGRIG GQAIARRLKPFGVQRFLYTGRQPRPQEAAEFQAEFV VPIAQLAAESDFIVVSCSLTPDTMGLCSKDFF

QKMKNTAIFINISR RGDVVNQEDLYQALASGQIAAAGLDVTTPEPLPPSHPLLTLKNCV VILPHIGSATYKTRNTMSLLAANNLLAGLRGEAMPSELK

L
Transcript ENSMUST00000045078
Sequence
AGGCCAGCCTGGTACGTGTTTGCTGCTGCGGGTCTTATGAAACCGGCGCGACTCATGAAGGTGTTCGTCACTGGCCCGTTGCCTGCCGAGGGCAGGGCTG

CGCTCGCCCAGGCCGCAGA - UNI19707 - CTGTGAGGTGGAACAGTGGAATTCGGATGACCCCATCCCCAGAAAGGATCTGGAGCAAGGTGTGGTG

GGGGCCCATGGCTTGCTCTGCCGCCTCTCTGACCGTGTGGACAAGAAACTTCTGGATGCCGCAG GAGCCAACCTCAGAGTCATCAGCACCTTGTCTGTG

GGGGTCGACCACTTGGCTTTGGATGAAATCAAGAAGCG CGGGATCCGGGTGGGCTACACGCCAGGTGTCCTGACAGATGCCACTGCAGAACTCGCCGTC

TCCCTCCTCCTCACCACCTGCCGCCGGTTGCCGGAGGCCATAGAGGAAGTGAAGAA CGGCGGCTGGAGCTCCTGGAGCCCATTATGGATGTGCGGCTAC

GGACTCTCGCAGAGCACTGTTGGCATTGTGGGGCTGGGGCGCATAG GTCAGGCCATCGCTCGACGACTGAAACCATTCGGTGTCCAGAGATTTCTTTAC

ACGGGGCGCCAGCCCAGGCCTCAGGAAGCAGCCGAGTTTCAGGCAGAGTTTG TGCCTATTGCTCAGCTGGCCGCAGAGTCAGACTTCATTGTCGTGTCC

TGCTCCTTAACACCCGATACCATGGGGCTCTGCAGCAAGGATTTCTTCCAGAAGATGAAGAACACAGCTATCTTCATCAACATCAGCAG AGGAGATGTG

GTAAACCAGGAAGACCTGTACCAGGCACTAGCCAGTGGTCAGATTGCAGCAGCGGGACTGGATGTGACCACCCCTGAACCACTGCCTCCGAGCCACCCCC

TGCTGACCCTCAAGAACTGCG TGATCCTGCCCCACATTGGCAGTGCCACCTACAAAACTCGCAACACCATGTCCTTGCTGGCGGCTAACAACTTGCTGG

CTGGCCTAAGAGGGGAGGCCATGCCCAGCGAACTCAAGCTGTAACCAGATGGGCTTTCATGGGCTGGAGACATCTTGCCAGACAGAGCCAAGCTGGACTT

CGGACTTTGGTGAGAGCCTGGGGCAGGCCTCCTCTACTGCATTTTCAGGGGACCTGGAAATGGGCAGATGGGCTTGCCACTTTGGGGGCTTGCCACATAC

TTGCCAAAAGCCTGTAATTCTAGCATTAAACAACTTCTGACACAGTG
Translation
MKPARLMKVFVTGPLPAEGRAALAQAAD - UNI19707 - DCEVEQWNSDDPIPRKDLEQGVVGAHGLLCRLSDRVDKKLLDAAG GANLRVISTLSV

GVDHLALDEIKKR RGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKN NGGWSSWSPLWMCGYGLSQSTVGIVGLGRIG GQAIARRLKPFGV

QRFLYTGRQPRPQEAAEFQAEFV VPIAQLAAESDFIVVSCSLTPDTMGLCSKDFFQKMKNTAIFINISR RGDVVNQEDLYQALASGQIAAAGLDVTTP

EPLPPSHPLLTLKNCV VILPHIGSATYKTRNTMSLLAANNLLAGLRGEAMPSELKL

For any suggestions or comments, please send an email to unitrap@crg.es