Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035649 (Zcchc7)
Chromosomal location
Chr 4: 44769440 - 44945087 (+)
Description
zinc finger, CCHC domain containing 7 Gene [Source:MGI (curated);Acc:Zcchc7-003]
RefSeq_dna
NM_177027 NM_138590 
RefSeq_peptide
NP_796001.1 NP_613056.2 
UniGene
Mm.331576 Mm.396025 Mm.404603 Mm.401668 
MGI
MGI:2442912 
Uniprot/SPTREMBL
Q3TZN5 Q8C915 Q9CYZ9 B1AX39 
Human Ortholog
ENSG00000147905 (ZCCHC7)
Omim not available
UniTrap UNI29934
Vector Insertion
Chr 4: 44769565 - 44774721
Public Clones (ggtc) D188B12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18137
Vector Insertion
Chr 4: 44774721 - 44775347
Public Clones not available
Private Clones OST429445 (lexicon) OST385950 (lexicon) OST304886 (lexicon) OST245541 (lexicon)
OST224397 (lexicon) OST135268 (lexicon) OST133287 (lexicon) OST116905 (lexicon)
OST116347 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11872
Vector Insertion
Chr 4: 44775347 - 44906404
Public Clones A068C04 (ggtc) IST14239E7 (tigm) IST14989C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7416
Vector Insertion
Chr 4: 44907914 - 44908690
Public Clones RRS739 (baygenomics)
Private Clones OST436372 (lexicon) OST431135 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35599
Vector Insertion
Chr 4: 44924932 - 44938846
Public Clones IST14742F3 (tigm) IST13003B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084635
Sequence
GGAAGTACCTTCTCCTCCCTGGAGTCCGCGCGGACGCGGCTTCCTTACCTCATTTGTCCTCGCCCCTCCCCGTTCCTCTACGCGTTTCGGTTCCTGGTTG

GTGCTTCCTGGTCGCGGCCGCGGCA - UNI18137 - - UNI29934 - CATTAAGGCAACTGACTTTCCATAATGTTTGGTGGCTATGAGACTATA

GAAGCATTTGAAGATGATCTTTATCGTGATGATTCATCTAGTGAACTGAGTGTTGATAGTGAGGTGGAATTTCAGCTCTACAGCCAAGTCCATTATGCCC

AGAGTATACATAATGCCAACAAGGAGGAAGGATATGAGGAAAAGAACTGTGAGAATTCGGAAACAGTGAGTAGTCAACCAAATCAGAAGAACTTAATCGT

CCTTTCAGATAGTGAGGTCATCCAGCTATCTGATACATCAGAGGTCATCACATTATCTGATGAAGATAGTATTTATAGATGTAAAAGAAAAAATATTGAA

GTCCAAGCGGAAGAAAAGACCCAGAGCCCTGCTACTTCTCATTCTAATAAAGTGGCTCAGAAATGCAAGAGGAATAATAAGAAGCCTAAACCTGAAGAGA

GGCCAGGTGTGATCCGAGAGGTCATGATCATAGAGGTCAGTTCAAATGAGGAGGAAGAAAGTACCACTTCAGAGAACGAAAATGTGGAAAGCTGGATGCT

CCTGGGGTCTGAGGAAGATGGTAAAGACAATGACATCCTTCTCAACTTGGTGGGGTGTGAGACCGCTGGTGCTGAAG - UNI11872 - - UNI1813

7 - ATGATGTAAATTGGTTCATCAGTGACAAAGACATCGAG GCCAAGATAGATAATAACAGATCATCTGGAAGGTGGAACAACCGATACTATTCAGTC

AACAAAAATGTCACCTGTAGAAATTGTGATAAACGTGGCCATTTGTCAAAAAACTGCCCCTTACCACAA - UNI7416 - AAAGTCCGGGCCTGCTGC

CTCTGCTCAGAGAGAGGACATCTCCAGTATGGCTGTCCAGCCCGTTACTGCTTAGACTGCTCTTTGCCCATGTCTTCCAACCACAGATGTTTTGAAAGAT

TGTCCTGGAGAAAACGATGTGACCGATGTGATATGATAGGCCACCATGCTGAC GCTTGCCCAGAAATCTGGAGGCAGTATCACCTAACGGTGAGTAAAA

ACACCTTTTTATTTTCCCCAAGACCCAGCCTATTTACCCTTCTCTGAACTGCTGACCATAAAATATAGACAAGCATCTTCTGCAGCAAGATAATAAACAT

CTGGAGAGTTTGTACTGAGAAAGCAATAATGCACCTCTCCCTTTCTCCTGCCCACTGCCTGCTCTTTATTTTCCTGTTTTTAAAAGATTTCAGCTGATTT

TTATTACTCATGTCATTAAATGATTCTATCATAATACCCTCAGGCTTAGATTATATTCACTAAATTAAAGGGGGAAAGTATTTTAGAGGCTATAAAACTG

CGTCTTTAGAACACTGTGTTACCACAGTCCATAAGCATACAGCCCACAATATCATCCATTATCACTTTCTGCTTTTGCTGAAATACATTCTTAACTGCAG

CTAGAAAAAGCTTAGTGTACCTTTCATATAGGACAATTCAACTCTCCTATCCTTAAAAGTCTATACTTGTTTGAATTATAGACATATATATTTAATAGTC

AATTTCTGATTTATTATTCAATTCTGATTTATTATGATTTTAGTCTTACTGAAAGCAGAAAATAACTATTGATGTATAATCCGTTTGATTAATTCTCAAT

ATAAAGTCAGCTCACTTTGACTTTCCAGTTTAAATAATGTCAGTAATTCAATATTGTCTTACTATTTAATACATTTTTGATGTATTAAATAGTACTGAGA

GACCATTTCTTTTAATTATACAGTTATATAGCACAATATAATTAATAGTTGTTGAAGTTTAGTATATAAAAGATTTTGTATGATACAGTTCAGAAAAGAG

AAAAGGCAGTTTTTTTAAAACATATCTTTATACTGCTTTCCTCTTACAGAGATATAAAGTGAGCCAACAGGCAGACTCATCTACCATTGTCTGCCCGGGC

CACAGTGCAAGGGATAGTAGTATATCTGCAGGGTTATCTAAAACTTTAGTGTTATATTAAATAAAAGTCATATACATGTCTATATATTATATACATATAT

GTGACAAATGCAGTCAGTGGATTATATTTTGGCATTGTAGCAGCTCTTTGGTAACATAATAATGGTAAAGCCCTTATAGCCTAAACCTGATAAGAACAGA

ATTATTCTTGTATCTCTCAAGGTCTCAGAGTCTCTGTATAGTGGTGTGGCAGTACTCGTTACTTTTATTAAGTAATACCATCATACATTTGACTTTGTAG

CTCTTTTAGCTTTTCCACTAATTTAAAGAATTTTTATGTGACTGTTATTGAATGATAAAAATTAGCTTCAAATGTAACAGAAGGTTAAAAGGTTTGTTGA

GTATTTTTTTAGCTTTTCAGAAACAAATTATAAAAAGAATAGAGATCTTTAAAAATGAAAACAAAATAAATTCATCTTTATTAGAATATAATATATTCTA

TCTGTAAGAATAACAAATTCAATTTGAAGTTTTCTTTATATGGAAACCTGGTTGATTTTCTTTCAGAAAATGTTGAAGTAATCATTGTAATTCACAACTA

TCAGGTTTTAATTAACAGTGAGTTATTATGCAAGAATAACTACAACAATAGTATGCTTATAAATGTGTAAATACTTTTATCAATCCATCTAAAATATAAT

CATTTTCCAATTATTTAAATTGCCTTATCAGTATATGGACAATATTTGAATGCCTGTAATTAAGCAGTATTAAATATTGAGTGAAAGCACACTGCATGCT

GATTTTAGCCATCTTCAGCCCTTTTACTAGGCGATGGACTGCCATCTATTGACTCAGAGTAGCCCTCACATGTGAACAGTGGCATCAGTCACAGCAGTGG

CCACAGAAGGAAGGAAGTTTGAATTGCCTCTTATGTACTCATTTCAACCAGCCTGCTTAAGGCTGTAAAGGTCGAGAGATCATTGTGATACATTCACTTC

TCCTCTGACCACAAAGTATCTATTTCTAACTCCAAAGGCACTGGACTTTGGGGTTACATTTCTTTTAGAACTTGTGTTTGGAACTGTTGACATTTGAGTG

CTTTTCACTTGCTGTGCCTGATTCCCAACTGATAAGATCTGGAGGATCATTTCCAGAACAAGTACACTTTAAGCAGCTACAAAATCGGGTCTAGGAAGCC

TCTCTCTTATAAACATGCAAGAAAGATGAAGATAAGTAACATAGACTTAGGAATTTTCAATTTTTCCTTACAATATTGTGAAATAAGATTTCAAAAGAGA

AGTTTTCATTATTTTCGGTAATATCAATGGTAAAATGAGGTTTCTAATAGATTATATCTAAATAAAGAGCTTTTAAACAAACTTGACTTGAATGCATTAA

TAAAAGGCAAATCCATCATTTCAAAAGACACACAGTGATACTGAGACTCTAAAGCACACCCCCAGCACAGCATGTGGCTCTACTGCTTTTCTTTATCCAT

TTCGATGACTAATTTAAAAAAAAAAATGTACCTTTTGATGTCTTTGTTGATCTGGAGACATATGTGAGAGAATTTATTTAAAAATTACCTATACTTCCTT

TTAAAAAAAAGAAAAAGCAAGCCTTTTGATATCTTTGCTGATCTGGAGACAAACATGAGGCGGGAAAATTAACAATTATGTAGTTTCCTCCAATAGCTAA

CACTTTTACTTCCTCAAAAAGTTAAAGTTTTTACATGTCTTAATCATATAACCCTATTCTTTACATTGTAACTTCTGCTTTCAGATTTTTAGCAAAGCCT

TGTCTTTTTCTTCATTCACATAGTTCCTTGTAGATTATTTCCCTATGAAAAAAGAAAGTCCTTTCTCCATCTCTTCCTTTCTTATGTTATAGCAAAAACA

CTAGGCTAATATGGCACCCACAGAGTTATATAGCCCATAGTATTTTTCTCTGATAGAAACTATAATTTAACATGCATTAGACATTCTTATCGTGTTTACT

TAAAAAGTAATCAGAAAATTGCAATTCAAAAGCTGTATATATTAAGAACCAAAAAGGTTAATGCATCTTTTATGTTTAATTTTGTGCTTGTTTTTTAATG

TATTTAAAATGCATTACAACCTTACTACTTCTTAGTTTAACTAAAAATTTCAGAATATGGAAGAGGATATAATTTTTATATGAGGTTAAGTTTTGGAATG

CTTAGAATTTATACTTCAAAAATGGAAATTTTTATTAACTAGGGAAGAGAAGAAAAATACATTTCCTTGTCTTCCTTTCTGGTCAGTGTTGACTAGCAGT

CAAGAGTACAACCCTGAACCCGCTGAATGGCGGAGTCTTCCAGACTGCAGTTCAAGTGCTCCATTCGTTTTCCCGGTCCACATTCTCTCCTTACCTGGGA

ACATCAGCCTACAAGTATACTGCTGAGTTTTCACAGAATGATTTTTACAGCAAATCAGAATTTTATCATCTAAAAAATTCTATGCTTTTTGCCACAGAAT

GGTGCCCCAAATATCAGCAGACTAAAGCTAACTTCAGAACTACTGTTTGACAGTCCAGAAGAAGAGAACAGGAGATAGGTGCTAAAGCTACAGCCATTCA

AATATCTTTTACCTTGGGATTGAGGTGTAAGGCAGGGTAAATATAACATCCCATGCTTTTCTT
Translation
 - UNI18137 - - UNI29934 - MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIHNANKEEGYEEKNCENSETVSSQPNQKNL

IVLSDSEVIQLSDTSEVITLSDEDSIYRCKRKNIEVQAEEKTQSPATSHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEESTTSENENVESW

MLLGSEEDGKDNDILLNLVGCETAGAED - UNI11872 - - UNI18137 - DDVNWFISDKDIE AKIDNNRSSGRWNNRYYSVNKNVTCRNCDKR

GHLSKNCPLPQ - UNI7416 - KVRACCLCSERGHLQYGCPARYCLDCSLPMSSNHRCFERLSWRKRCDRCDMIGHHAD ACPEIWRQYHLTVSKNTF

LFSPRPSLFTLL
Transcript ENSMUST00000107823
Sequence
GAGATGGGTCTTCTGTAGCTGGGAGCTTGCTGTGTAATTGAAGCTGGCCTTGAACTCCTGATCTTCCTGCCTCTACCTCCTGAATACTGGGATCACAGGT

GCGTGTCACCATGCCCAAACCATGAATAGCTTTTAACAGCTTTGTCCTTAAAAAATTACAATATCTCTTTGATTTTGTTTTCTTTCTGTATGTTTTGCAG

TTGTATTTCCTATTAAAACAACAGCCATTTTTTTGGATAAGGAAAAAATATTTCTGTGTAATAATTTAATAACTTCTGGAACTCTACCACCCAAAGGAAA

GCCACTGCAGTGACACTTGCCTATACACATGCATCTCTGTTAACGTCTATTTAGTAGTTTTGAGAATAGTCGTGTTTTTCTTGTATCCTAGTTGGTGATA

GCTGAGGTTGTAAATGCTGTTATATGTACCAGGATCATTTTCAGCAGAAAAGGCTGGTCAAGTTTTATTTTTCTCAAATGTAATGATGAATCTTATTAAC

TTGATTAAATTAATAGCAACTAGGAGCTTACTAAGGCATGCCTTTAGTTGTGTCTGAGGGGCAGATAGTTGGGGTTTCTAACCTAAAGAATGGTTTATTC

AATTAATAGAGTCAAATCTGAATAGACTGTTGGGAGGTGGAGAAAGTCAGTAAAGCTGAGAAAGGGTGTGTGTGCTCCTGGAGGTTCTGTGCTGCTCTGG

CATCCTCCATTACTGCTCTGTTTCCTGTCTGCTGTGCTGTGAGCTTCTCTAGACACCTTCCCTGCTGTGATGCACTGAAGTCTCTGAGACTGAGCAAAGT

ACACTGTCTCCCCTAAGGCCTATGTCAGTGCTCCATCACAGCACTGGGCAGGGTAACCAGCAATCCAGCTTTTCATTCTAAGACATAAGAGCTACAGTAC

GGTTTTTTTAAAGATTCTTTTCTTATCTATACACTATTTTTCTATATCAAGAACTCCTCTCTCACCTATGCCTGCAACCCCAAACCACCTGATTGCAGCA

TTAGATAAAATGTTAGTAAGCAGACTAGCGCTCTATTACAGAAACTCAGTAAGCATGAGAGAGAAATTTACCAAAGTGCATACAGAAAAGGGAACAAATA

AAGATGGCATTTTCTTCTTCTCGGTTAAATCCACTACCTTCTTGAGGGTCTGCTCTGGCCCCTGTCTGTCCTCTCCTTTCAACTCTCCCTCTCAGCTAGC

CTCATCTGGCTGCTCCCACTAAAAATGCCACCAACCAACTCTTCCTCCTAAGCACTGTCCTTTTATCCTGTCCTTCCTTGTTGGTGCTTCTCAATAATCT

ATGCCTGCTCCCTTTTGTCAGCTTATATTCAGTGTAGATGCTGAAAATACTTAAGATATAAGTATAATTTAATAAATAAGCTGCATAGCTTTCTCCACAT

CCCTTCTGTCCTTACCCTGCTCTCTGCCCTCCCAGGTTCTCACAGGGAGGCCCCATGGATGGTCGAATATGAGATAGCTGTGCATCATGTTGCTAGGTTT

CTGTTGTGCTTGGCAGTGTAGGTCAGACCCTCCTTGAAAGTATCCTTTAAGTCCTGGGCTCTGTCCTGTGTCTCCTCAGCCCTGAACCATCCCTTCTCTG

TCCTTTCGTGAGCTCTGTCTGCCCCTTACATGTTGTTTCCTGGGCTCTATCATGAGCCCACCCTCACTCCACTCCACTCCACTCCACTCCACTCTAAGAA

GCAATATCCCTAAGGATTTTCTTACCATAGAGTTCTTTTAGAAAGGATGGGCTTTTAGCTTTTCCTCTAATATGTATTAACTTCTTATAAATATTTATGT

TGCAGACCAAACCTGGACCACCAAAAAAGCCAAAGACCCCTTCTGGACAATCAGCGTTAGTGTATTGCTACAACTGTGCACAGAAAGGCCATTATGGACA

T GAATGTACAGAGAGACGAATGTTTAACCAGACGTTTCCAACATCTCCATTCATATATTGCTATGATGGCAAATATGACATCCAGCAAAGGGATCGGAG

AATAAAGCGAAAAGTCAAAG ATCTCAAGAAAAATGGAGACTTTCCAAGGCAGTTCAAAAGACCACATGTAGAAGAGACAGATAAGAGGCGCCACCACGA

TATGAGAAAAAGCCGTTCCCCAAGAAAATACAGGAGGTGGCCTCGAGAAAATAAAGAAACACAGAAAGAAAAGACCAGGAGTAGAGAAGGCAAGACGCAC

AGGAGGGGTCACCAGCCTCGGGGTGAGGATGAAGACTTCCCCAGGGGCTCAAAACCCAACGCCTCTGGCTGCGCTAACAACCAGAAGCCTTCTAAGTCCC

TCCACCATGCATCCCATTACCACAGGCTGAGAGAAGAGCGGCTTCTCAGGGAGAGCAAGCGGAGCAAGCCAAAGAAAAGGAAGAGTACAGAGGACGGCAG

CCATGATGATTTGTTTCTTATTAAGCAAAAGAAGAAGAAGCCTAAGCCGAGTGGTCTCTGACCTGGTCTCCGCGCTTCAGTGTCCTGGAAGTGCTTAAGT

ACCTGTTAATGAGACGCTGGGATTGAATGCTGAGTTCCGGCCATGCCTGGAGTGGCTGTACAGAGACCACAAAGAGTTCAGGTCTGTGTCCACAGGCTGT

TCCTAGGTAGGAAGGCAAACTTGAGGTAGAAAATTGTCTTTTCATGAAAACCTTTTTAAATGCTTTGGAAAAATTACAAGCTCATCAGATGATTTTATCT

CCAATGTTTGAGGACTTAAAAGCTCATTGGAAGAAAGTTTATTGTTAAGAAAAGTCATCACTTTTTTAGCTTTTTTTTTAAGAACACTGGAAAAATCAAT

GAAAATCCAAGCCCGGCTTTGCTTGCATCAGAGGCTGTTGGAATCTCTCTCTGTACAGAACAGCATGTAAAATGAAGCTGTCACCATTGAATTCTGGAGG

AGGTGGAGGAGAGGACATAGCAAATACACAAACAAAATGTGCGCAGTGTGGGCTTGCAGGACGGAGGTGTGAAAGGCATCCTCAAACTTGAGTGCAATGG

CAGGGACATTTTGTTCGCACTGTTAACAGCCATAGTTCAAGAGACAGGGATACATACCATCAACCTAACTTGTCCTCGTGGATCCTTTTAAACACTTCAA

CGCTCTTTAGAATCTTTTGTACTTGTGAGCCTTTTTTACCCTTGTGAAAGCCTAATGTTAGAATAAGAAAAATAAAATGCCTGAAACC
Translation
MLQTKPGPPKKPKTPSGQSALVYCYNCAQKGHYGH ECTERRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKD DLKKNGDFPRQFKRPHVEETDKR

RHHDMRKSRSPRKYRRWPRENKETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCANNQKPSKSLHHASHYHRLREERLLRESKRSKPKKRKST

EDGSHDDLFLIKQKKKKPKPSGL
Transcript ENSMUST00000107824
Sequence
GGAAGTACCTTCTCCTCCCTGGAGTCCGCGCGGACGCGGCTTCCTTACCTCATTTGTCCTCGCCCCTCCCCGTTCCTCTACGCGTTTCGGTTCCTGGTTG

GTGCTTCCTGGTCGCGGCCGCGGCA - UNI18137 - - UNI29934 - CATTAAGGCAACTGACTTTCCATAATGTTTGGTGGCTATGAGACTATA

GAAGCATTTGAAGATGATCTTTATCGTGATGATTCATCTAGTGAACTGAGTGTTGATAGTGAGGTGGAATTTCAGCTCTACAGCCAAGTCCATTATGCCC

AGAGTATACATAATGCCAACAAGGAGGAAGGATATGAGGAAAAGAACTGTGAGAATTCGGAAACAGTGAGTAGTCAACCAAATCAGAAGAACTTAATCGT

CCTTTCAGATAGTGAGGTCATCCAGCTATCTGATACATCAGAGGTCATCACATTATCTGATGAAGATAGTATTTATAGATGTAAAAGAAAAAATATTGAA

GTCCAAGCGGAAGAAAAGACCCAGAGCCCTGCTACTTCTCATTCTAATAAAGTGGCTCAGAAATGCAAGAGGAATAATAAGAAGCCTAAACCTGAAGAGA

GGCCAGGTGTGATCCGAGAGGTCATGATCATAGAGGTCAGTTCAAATGAGGAGGAAGAAAGTACCACTTCAGAGAACGAAAATGTGGAAAGCTGGATGCT

CCTGGGGTCTGAGGAAGATGGTAAAGACAATGACATCCTTCTCAACTTGGTGGGGTGTGAGACCGCTGGTGCTGAAG - UNI11872 - - UNI1813

7 - ATGATGTAAATTGGTTCATCAGTGACAAAGACATCGAG GCCAAGATAGATAATAACAGATCATCTGGAAGGTGGAACAACCGATACTATTCAGTC

AACAAAAATGTCACCTGTAGAAATTGTGATAAACGTGGCCATTTGTCAAAAAACTGCCCCTTACCACAA - UNI7416 - AAAGTCCGGGCCTGCTGC

CTCTGCTCAGAGAGAGGACATCTCCAGTATGGCTGTCCAGCCCGTTACTGCTTAGACTGCTCTTTGCCCATGTCTTCCAACCACAGATGTTTTGAAAGAT

TGTCCTGGAGAAAACGATGTGACCGATGTGATATGATAGGCCACCATGCTGAC GCTTGCCCAGAAATCTGGAGGCAGTATCACCTAACG - UNI3559

9 - ACCAAACCTGGACCACCAAAAAAGCCAAAGACCCCTTCTGGACAATCAGCGTTAGTGTATTGCTACAACTGTGCACAGAAAGGCCATTATGGACAT

 GAATGTACAGAGAGACGAATGTTTAACCAGACGTTTCCAACATCTCCATTCATATATTGCTATGATGGCAAATATGACATCCAGCAAAGGGATCGGAGA

ATAAAGCGAAAAGTCAAAG ATCTCAAGAAAAATGGAGACTTTCCAAGGCAGTTCAAAAGACCACATGTAGAAGAGACAGATAAGAGGCGCCACCACGAT

ATGAGAAAAAGCCGTTCCCCAAGAAAATACAGGAGGTGGCCTCGAGAAAATAAAGAAACACAGAAAGAAAAGACCAGGAGTAGAGAAGGCAAGACGCACA

GGAGGGGTCACCAGCCTCGGGGTGAGGATGAAGACTTCCCCAGGGGCTCAAAACCCAACGCCTCTGGCTGCGCTAACAACCAGAAGCCTTCTAAGTCCCT

CCACCATGCATCCCATTACCACAGGCTGAGAGAAGAGCGGCTTCTCAGGGAGAGCAAGCGGAGCAAGCCAAAGAAAAGGAAGAGTACAGAGGACGGCAGC

CATGATGATTTGTTTCTTATTAAGCAAAAGAAGAAGAAGCCTAAGCCGAGTGGTCTCTGACCTGGTCTCCGCGCTTCAGTGTCCTGGAAGTGCTTAAGTA

CCTGTTAATGAGACGCTGGGATTGAATGCTGAGTTCCGGCCATGCCTGGAGTGGCTGTACAGAGACCACAAAGAGTTCAGGTCTGTGTCCACAGGCTGTT

CCTAGGTAGGAAGGCAAACTTGAGGTAGAAAATTGTCTTTTCATGAAAACCTTTTTAAATGCTTTGGAAAAATTACAAGCTCATCAGATGATTTTATCTC

CAATGTTTGAGGACTTAAAAGCTCATTGGAAGAAAGTTTATTGTTAAGAAAAGTCATCACTTTTTTAGCTTTTTTTTTAAGAACACTGGAAAAATCAATG

AAAATCCAAGCCCGGCTTTGCTTGCATCAGAGGCTGTTGGAATCTCTCTCTGTACAGAACAGCATGTAAAATGAAGCTGTCACCATTGAATTCTGGAGGA

GGTGGAGGAGAGGACATAGCAAATACACAAACAAAATGTGCGCAGTGTGGGCTTGCAGGACGGAGGTGTGAAAGGCATCCTCAAACTTGAGTGCAATGGC

AGGGACATTTTGTTCGCACTGTTAACAGCCATAGTTCAAGAGACAGGGATACATACCATCAACCTAACTTGTCCTCGTGGATCCTTTTAAACACTTCAAC

GCTCTTTAGAATCTTTTGTACTTGTGAGCCTTTTTTACCCTTGTGAAAGCCTAATGTTAGAATAAGAAAAATAAAATGCCTGAAACCATGTGTAAATAAA

Translation
 - UNI18137 - - UNI29934 - MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIHNANKEEGYEEKNCENSETVSSQPNQKNL

IVLSDSEVIQLSDTSEVITLSDEDSIYRCKRKNIEVQAEEKTQSPATSHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEESTTSENENVESW

MLLGSEEDGKDNDILLNLVGCETAGAED - UNI11872 - - UNI18137 - DDVNWFISDKDIE AKIDNNRSSGRWNNRYYSVNKNVTCRNCDKR

GHLSKNCPLPQ - UNI7416 - KVRACCLCSERGHLQYGCPARYCLDCSLPMSSNHRCFERLSWRKRCDRCDMIGHHAD ACPEIWRQYHLT - UNI

35599 - TKPGPPKKPKTPSGQSALVYCYNCAQKGHYGH ECTERRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKD DLKKNGDFPRQFKRPHVE

ETDKRRHHDMRKSRSPRKYRRWPRENKETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCANNQKPSKSLHHASHYHRLREERLLRESKRSKPK

KRKSTEDGSHDDLFLIKQKKKKPKPSGL
Transcript ENSMUST00000067521
Sequence
CATTAAGGCAACTGACTTTCCATAATGTTTGGTGGCTATGAGACTATAGAAGCATTTGAAGATGATCTTTATCGTGATGATTCATCTAGTGAACTGAGTG

TTGATAGTGAGGTGGAATTTCAGCTCTACAGCCAAGTCCATTATGCCCAGAGTATACATAATGCCAACAAGGAGGAAGGATATGAGGAAAAGAACTGTGA

GAATTCGGAAACAGTGAGTAGTCAACCAAATCAGAAGAACTTAATCGTCCTTTCAGATAGTGAGGTCATCCAGCTATCTGATACATCAGAGGTCATCACA

TTATCTGATGAAGATAGTATTTATAGATGTAAAAGAAAAAATATTGAAGTCCAAGCGGAAGAAAAGACCCAGAGCCCTGCTACTTCTCATTCTAATAAAG

TGGCTCAGAAATGCAAGAGGAATAATAAGAAGCCTAAACCTGAAGAGAGGCCAGGTGTGATCCGAGAGGTCATGATCATAGAGGTCAGTTCAAATGAGGA

GGAAGAAAGTACCACTTCAGAGAACGAAAATGTGGAAAGCTGGATGCTCCTGGGGTCTGAGGAAGATGGTAAAGACAATGACATCCTTCTCAACTTGGTG

GGGTGTGAGACCGCTGGTGCTGAAG - UNI11872 - - UNI18137 - ATGATGTAAATTGGTTCATCAGTGACAAAGACATCGAG GCCAAGATA

GATAATAACAGATCATCTGGAAGGTGGAACAACCGATACTATTCAGTCAACAAAAATGTCACCTGTAGAAATTGTGATAAACGTGGCCATTTGTCAAAAA

ACTGCCCCTTACCACAA - UNI7416 - AAAGTCCGGGCCTGCTGCCTCTGCTCAGAGAGAGGACATCTCCAGTATGGCTGTCCAGCCCGTTACTGCT

TAGACTGCTCTTTGCCCATGTCTTCCAACCACAGATGTTTTGAAAGATTGTCCTGGAGAAAACGATGTGACCGATGTGATATGATAGGCCACCATGCTGA

C GCTTGCCCAGAAATCTGGAGGCAGTATCACCTAACG - UNI35599 - ACCAAACCTGGACCACCAAAAAAGCCAAAGACCCCTTCTGGACAATCA

GCGTTAGTGTATTGCTACAACTGTGCACAGAAAGGCCATTATGGACAT GAATGTACAGAGAGACGAATGTTTAACCAGACGTTTCCAACATCTCCATTC

ATATATTGCTATGATGGCAAATATGACATCCAGCAAAGGGATCGGAGAATAAAGCGAAAAGTCAAAG ATCTCAAGAAAAATGGAGACTTTCCAAGGCAG

TTCAAAAGACCACATGTAGAAGAGACAGATAAGAGGCGCCACCACGATATGAGAAAAAGCCGTTCCCCAAGAAAATACAGGAGGTGGCCTCGAGAAAATA

AAGAAACACAGAAAGAAAAGACCAGGAGTAGAGAAGGCAAGACGCACAGGAGGGGTCACCAGCCTCGGGGTGAGGATGAAGACTTCCCCAGGGGCTCAAA

ACCCAACGCCTCTGGCTGCGCTAACAACCAGAAGCCTTCTAAGTCCCTCCACCATGCATCCCATTACCACAGGCTGAGAGAAGAGCGGCTTCTCAGGGAG

AGCAAGCGGAGCAAGCCAAAGAAAAGGAAGAGTACAGAGGACGGCAGCCATGATGATTTGTTTCTTATTAAGCAAAAGAAGAAGAAGCCTAAGCCGAGTG

GTCTCTGACCTGGTCTCCGCGCTTCAGTGTCCTGGAAGTGCTTAAGTACCTGTTAATGAGACGCTGGGATTGAATGCTGAGTTCCGGCCATGCCTGGAGT

GGCTGTACAGAGACCACAAAGAGTTCAGGTCTGTGTCCACAGGCTGTTCCTAGGTAGGAAGGCAAACTTGAGGTAGAAAATTGTCTTTTCATGAAAACCT

TTTTAAATGCTTTGGAAAAATTACAAGCTCATCAGATGATTTTATCTCCAATGTTTGAGGACTTAAAAGCTCATTGGAAGAAAGTTTATTGTTAAGAAAA

GTCATCACTTTTTTAGCTTTTTTTTTAAGAACACTGGAAAAATCAATGAAAATCCAAGCCCGGCTTTGCTTGCATCAGAGGCTGTTGGAATCTCTCTCTG

TACAGAACAGCATGTAAAATGAAGCTGTCACCATTGAATTCTGGAGGAGGTGGAGGAGAGGACATAGCAAATACACAAACAAAATGTGCGCAGTGTGGGC

TTGCAGGACGGAGGTGTGAAAGGCATCCTCAAACTTGAGTGCAATGGCAGGGACATTTTGTTCGCACTGTTAACAGCCATAGTTCAAGAGACAGGGATAC

ATACCATCAACCTAACTTGTCCTCGTGGATCCTTTTAAACACTTCAACGCTCTTTAGAATCTTTTGTACTTGTGAGCCTTTTTTACCCTTGTGAAAGCCT

AATGTTAGAATAAGAAAAATAAAATGCCTGAAACC
Translation
MFGGYETIEAFEDDLYRDDSSSELSVDSEVEFQLYSQVHYAQSIHNANKEEGYEEKNCENSETVSSQPNQKNLIVLSDSEVIQLSDTSEVITLSDEDSIY

RCKRKNIEVQAEEKTQSPATSHSNKVAQKCKRNNKKPKPEERPGVIREVMIIEVSSNEEEESTTSENENVESWMLLGSEEDGKDNDILLNLVGCETAGAE

D - UNI11872 - - UNI18137 - DDVNWFISDKDIE AKIDNNRSSGRWNNRYYSVNKNVTCRNCDKRGHLSKNCPLPQ - UNI7416 - KVR

ACCLCSERGHLQYGCPARYCLDCSLPMSSNHRCFERLSWRKRCDRCDMIGHHAD ACPEIWRQYHLT - UNI35599 - TKPGPPKKPKTPSGQSALV

YCYNCAQKGHYGH ECTERRMFNQTFPTSPFIYCYDGKYDIQQRDRRIKRKVKD DLKKNGDFPRQFKRPHVEETDKRRHHDMRKSRSPRKYRRWPRENK

ETQKEKTRSREGKTHRRGHQPRGEDEDFPRGSKPNASGCANNQKPSKSLHHASHYHRLREERLLRESKRSKPKKRKSTEDGSHDDLFLIKQKKKKPKPSG

L

For any suggestions or comments, please send an email to unitrap@crg.es