Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035656 (AC139244.4)
Chromosomal location
Chr 16: 32736466 - 32775044 (+)
Description
Mucin Fragment  [Source:UniProtKB/TrEMBL;Acc:Q9ERM1]
Uniprot/SPTREMBL
Q9ERM1 
Human Ortholog
not available
Omim not available
UniTrap UNI31678
Vector Insertion
Chr 16: 32736552 - 32750331
Public Clones IST13781E5 (tigm) IST13652C2 (tigm) IST12163H12 (tigm) IST13553A11 (tigm)
IST13746G10 (tigm) IST13652C9 (tigm) IST13578B9 (tigm) IST11381E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096106
Sequence
ATGAGAGGGCCTCACTGGAGAGTTCCCTGGCTGTGTCTGAGCTGCCTGTATTCTTGCCTCCTCTTGCTACCTGGTAAGACAAGAAT - UNI31678 - 

CACCAGAACATCCCAAATGAGCTCACAAGCATCGACCTCATCAACATCTTCTGACAGAAGGACAAGTAAAACAGAACAAACATCAACAAGGGATACTCCA

AGTTCCATAACAACAGTTTCTCAGAGCCATCATACTACAAGCATGGAGACCAGCAAACCTCAAACCACCACAACCACCGAGGTGACCACATCAACTCCTT

CAGCCTCCTCACGTGACCAAATACAGACAGAGACAAGTTCTCAAAGAACAATCTCTCCTGATGGAACAACCACCTCACATGCTCCCAGTATCAGCAGCTC

AGCTCCAAGTACAACACACATGTTAACCACAACATCCTCCACAGAAAGTACCTCAGTAGACTCAGGACACACAACAGCAATAACAACTCAAGGTTTAACA

CCTGCCACCGCACAAGTCTCACTGACACCTTCATCCCAGAATATGTCAACAGTGTCAACACCCATCACCTCAACTCTTACTCAGAGACAACACACTGGAA

GCAAGCAGACCAGCAGCAAATCTCAA AACCAACACACTGAAAGCATGGACACCAGCAGACAACCTCAAACCACCACAACCATAGAGGTGACCACATCAA

CCCCTTCAGCCTCCTCACTTCACCAAATTCAGACAGAGACAAATTCCCCAAAAACAATCTCTCCTGGTGAGACAACCACCTCACATGCTCCGAACATGAG

AAGCTCACCACCAAAGACATCACAGATACTAACCACAATGCCCTCCACAAAAAGTACCTCAGTAGACACAAAACAAACAAAGGCAATAACTACTAAAGTT

TCTACACCTGACACCACACAGGTCTCGATGACACCTTCATCCCAGAAATTGCCAACACACAGCACGTCTACTCAGGAATTAACATCTTCTTACAGCCAAC

ATATTCAAAGCAAGGGGACCAGCAGCAAATCTCAAACAACCACAAACACCAAGGTGAACACATCAACTCCTTCAGCCTCCTCACGTGACAAAATTCAGAC

AGAGACAAGTTCCCAAAGAACAAACTCTCCTGGCGAGAAAAGGACATCACATGCTCCCAGCATGAGCAGCTCAGCTCCAAGTACAACACACATGTTATCC

ACAACATCCTCCAATCAAAGTACCTCAGTAGACACAGGACAAACAACATCAGTAACAGCTCAAGGTTCTACACCTGCCATCACACAGACCTCATTGACAC

CTTCATCCCAGAATACGTCAACAGTGTCAACACCCATCACCTCTACTCACAAATTGTCAACCCTTTCTCAGAGCCAACACACTGGAAGCAAGGGGACCAG

CAGCAATCCTCAAACTACCACCACCACAGAGGTGACCACATCAACTCCTTCAGCCACCACCCATGACCAAATTCAGACAGAGACAAGTTCCCAAAACACA

ATCTCTCCTGGTGAGACAACCACCTCATATGCTCCCATCATGAGCAGCTCAGCTCCAAGTACAACAC TGGTGACCACATCAAATCCTTCAGCCACCTCA

CGTGACCAAATTCAGACAGAGACAAGTTCCCAAAGAACAATCTCTCCTGGTGAGACAACCACCTCATATGCTTCCATCATGAGCAGCTCAGCTCCAAGTA

CAACACACATGTTAACCACAACATCCTCCACTCAAA GTGAGACAACCACCTCACATGCTCCCATCATGAGCAGCTCAGCTCCAAGTACAACACACATGT

TATCCACAACATCCTCCACTCAAAGTACCTCAGTAGACACAAGACACACAACAGCAGGAAGGACTCAAGGTTCTACACCTGCCACCACACAG AACATGT

CAACAGTGTCAGCTCCCATCACCTCAACTCAAATTTTGTCAACCCTTCCTCAGAGCCAACACACTGGAAGCAAGGGGACCAGCACCAATCCTCAAACTAC

CACCAATGCAGAGGTGACCACATCAACTCCTTCAGCCACCTCACATGACCAAATTGAGACAGAAACAAGTTCCCAAAGAACAATCTCTCCTGGTGAGACA

ACCACCTCACATGCTCCCAAC ACAGAGACAAGTTCCCAAAGAACAATCTCTCCCGGCAAGACAACCACCTCACATGTTCCCAACATGAACAGCTCAGCT

CCAAGTACAACACACATCTTATCCACAACATCCTCCATTCAAAGTACCTCAGGAGATACAAGACACACAACAGCAGTAAGGACTCAAGGTTCTACACCTG

CCACCACACAGGTCTCACTGGCACCTTCATCCCAGAACATGTCAACACTGTCAGCACCCATCACATCACCTCAACATTTTTCAACCCTTCCTCAGAACCA

ACACACTGGAAGCATGGGGACCAGCAGCAATCCTCAAAGTACCACCATCCCAGAGGTGACCACATCAACTCTTTCAGCTTCCTCACGTGACCAAGTTCAG

ACAGAGACAAGTTCCCAAAGAACAATCTCTCCTGGTGAGACAACCACCTCACATGCTTCCAGCTTGAGCAGTTCAGCTCCAAGTTCAACACACATGTTAT

CCACAGCATCCTCCACTGAAATTACCTCAGGAGACACAAGACACACAACAGCAATAGTGACTCAAGGTTCTACACCTGCCACCACACAGACCACATTGAC

ACCTTCGTCCCAGAATATGTCAACAGTGTCAACACCCATCACTTCTACTCACAAATTGTCACCCCTTCCTCAGAGCCAACACACTGAAAACATGGGGACC

AGCAGCAATCCTCAAACTACCACCACCCCAGAA AGCCAACACACTGGAAGCAAGGGGACCAGCAGCAATCATCAGACTACCACTACCCCTGTGGTGACC

ACATCAACTTCTTCAGCCACCTCACGTGACCAAATTCAGACAGAGACAAGTTCCCTAAGAACAATCTCTCCTGATGGAACGACCACCTCACATGCTTCCA

GCATGAGCAGTTCATCTCCAAATACAACACACTTGTTAATCACTACATCCTCCACAGAAAGTACCTCAGTAGACACAGGATACTCAACAGTAATAACGAC

TCATGGTTCTACACTTGCCACCACCCAGGTCTCATTGACACCTTCATCCCAGAATATGTCAA GATTGACTACGAAGACAGACAATGACAGAAACACAGC

AGTCTCAGCCACCTCCTCGACCCTTACTAGCCCCAGCCCAACCACAGCCTCCAGGTCAACAGTGCCCCTGCCTTCTCTTTTACCAGATCAGG GCATTTC

CCTCTTCCCCTACGGGTCTGAAGTCGGAGACCAGAATTTGTTTGCCAGGACTGTGGATTTTAACTCACCAATCTTCAAGATCCTGATTGGCTTTCCCCTC

GGTTCCTCCCTGCGGGATTCCTTCTAC GTTACAGATAATGGTCAGATCATTTTCCCAGAGTCAGACTATGACGTCTTCTCCTACCCCAACCCACCTCAA

AGAGGCTTCACCGGAAGGGAGCGCGTGGCCATGGTGGCCCCGTTCTGGGCTGATGCTGATTTCTCTAGCTCCAGGGGAGCCATATTTTACCAG GAATAT

GTCACATTTTACAATGAACACCATCAGCTAATCCGGGAAGTGGAGACTTTGATTAATGATTTCACAAGTAGCTGGGGCTACAGAGCCAAGTGGACACTGA

AGGTCACCTGGGTCAATGTTCCTGCCTATACTGCCCAAGAGAGCTTTGGG ACCAATACCTACCAAGCCATCCTCTCCACAGATGGGAGCAGGTCCTATG

CCCTGTTTCTCTACCAGAACAGTGGCATGAGGTGGGATGTGACCCAGGAACCATACAACCGGGTGCTCATGGGCTTCTCCAG TGGAGATGGGTATTTTG

AAAACAGCCCGCTGACATTCCGGCCAGCAATGGAGAAGTACCGTCCAGATCGATTCCTGAATTCCAAATTAG GCATCCGGGGACTGCAGGTCTACAGGC

TGCACAGGGAGGAGCGGCCCAACTACCGGCTCAAATGTCTGCAGTGGCTGGAGAGTCAGCCTCAGCAGCCCAGCTGGGGCTGGAGCTCAGTTTCCTGCCC

TTGCTCCTGGCAGCAGGGACAACGGGACTTTCGGTTCAGGCCCATCAACCCAG GTTGGTGGGACAGGCAGCTGTGCAGCTTCTCCTCCGGGCGAGGGGG

TGTGTGCTGCAGCTATGGTGCCTGGGGAGAGTTTCGAGAAGGCTGGAGAATGCACAGTCCTTGGCAGTTTG ATGAGGAGCAGGAGGCACAGAACTGGTG

CTGCCAATGGAACGACAAGCCCTCGTTCTGTGTCTGGTACCAGCTTAGGCGGCCCCGTGTCAGCTGTGCTGGGTACAGGCCCCCACGGCCCG CTTGGAC

ATTTGGTGATCCCCACATCACCACTTTGGATAATGCCAACTTCACCTTCAACGGGCTGGGAGACTTTCTGCTGGTCCAGGCCCAGGACAGAAATTCTTCC

TTCCTGCTGGAAGGCCGCACTGCCCAGACTGGCACTGCCAAGGCCACTAACTTCATTGCCTTTGCGGCTCAATACAACACCAGCAGCCTGAAGTCTCCCA

TCACG GTTCAGTGGTTTCTTGAGCCCAGTGACAAAATCCGAGTCGTATACAATAACCAGACTGTGGCCTTTAACACCAGAGACACTGAAG TCTTACCC

ATATTCAATACCACCGGTGTTCTGCTGACCCAAAATGGCTCCCAAGTCTCAGCCAACTTTGATGGGACAGTGACTATCTCTGTGATTGCTCGCTCCAACA

TCCTTCATGCCTCCTCCAGCCTATCAGAGGAATATCGAAACCACACAGAGGGCCTTCTGG GAGTGTGGAATGACAATCCAGAAGATGACTTCAGGATGC

CCAATGGCTCCACCATTCCCTCAAACAGCTCTGAGGAGACCCTTTTCTACTATGGAATGACAT GGCACGTCAACGGAACAGGCCTCCTTGGGATAAGGG

CAGACCCGCTGCCTACCAAGTTCACCCCCATCTTTCTGTCTCAACTGTTGAATCAGAGTGCCTCAGGTGAAGACTTGGCCTCTGGGTGCAAAGGCGACAG

AAAGTGCATGTTTGACATCCTGGCCACGGGAAACAGAACTATTGGACAAAGCACCAATTCCATCCTTAATGAGTTCCAACATATGAATGACACCCTCA A

TCAGTACCCACCCTCTATCAACTGCAGCAGCAAGATTCAAGCCTACAAGGGGCAGACAGTGACCACTGAGATCACCAGCAACTCTAAGGATGCCACACTC

AGCCTCTCCAAGAAATGTAGTGGCTTTAAGCTCTTTG AAAACGGGAGTTTGCAGTGGACACCAACATCCCCAGAAGCGTGTACCCTGGAGATTCTAGCG

AGGGATGTCAGGACTAACTTGTCATGGGTACTCCAGCCCAAGACCGTGGCTTGCTTCTGCAGTAAGGAGGAGCAGTGTTTGTACAATGAAACCAGCAAAG

AGGGCAATTCTTCCCTTGAGGTGAGTAGTGGAGGCTGGGGGAGGCGGGCAAGTGGAGGGATG
Translation
MRGPHWRVPWLCLSCLYSCLLLLPGKTRI - UNI31678 - ITRTSQMSSQASTSSTSSDRRTSKTEQTSTRDTPSSITTVSQSHHTTSMETSKPQTT

TTTEVTTSTPSASSRDQIQTETSSQRTISPDGTTTSHAPSISSSAPSTTHMLTTTSSTESTSVDSGHTTAITTQGLTPATAQVSLTPSSQNMSTVSTPIT

STLTQRQHTGSKQTSSKSQ NQHTESMDTSRQPQTTTTIEVTTSTPSASSLHQIQTETNSPKTISPGETTTSHAPNMRSSPPKTSQILTTMPSTKSTSVD

TKQTKAITTKVSTPDTTQVSMTPSSQKLPTHSTSTQELTSSYSQHIQSKGTSSKSQTTTNTKVNTSTPSASSRDKIQTETSSQRTNSPGEKRTSHAPSMS

SSAPSTTHMLSTTSSNQSTSVDTGQTTSVTAQGSTPAITQTSLTPSSQNTSTVSTPITSTHKLSTLSQSQHTGSKGTSSNPQTTTTTEVTTSTPSATTHD

QIQTETSSQNTISPGETTTSYAPIMSSSAPSTTL LVTTSNPSATSRDQIQTETSSQRTISPGETTTSYASIMSSSAPSTTHMLTTTSSTQS SETTTSH

APIMSSSAPSTTHMLSTTSSTQSTSVDTRHTTAGRTQGSTPATTQ NMSTVSAPITSTQILSTLPQSQHTGSKGTSTNPQTTTNAEVTTSTPSATSHDQI

ETETSSQRTISPGETTTSHAPN TETSSQRTISPGKTTTSHVPNMNSSAPSTTHILSTTSSIQSTSGDTRHTTAVRTQGSTPATTQVSLAPSSQNMSTLS

APITSPQHFSTLPQNQHTGSMGTSSNPQSTTIPEVTTSTLSASSRDQVQTETSSQRTISPGETTTSHASSLSSSAPSSTHMLSTASSTEITSGDTRHTTA

IVTQGSTPATTQTTLTPSSQNMSTVSTPITSTHKLSPLPQSQHTENMGTSSNPQTTTTPE SQHTGSKGTSSNHQTTTTPVVTTSTSSATSRDQIQTETS

SLRTISPDGTTTSHASSMSSSSPNTTHLLITTSSTESTSVDTGYSTVITTHGSTLATTQVSLTPSSQNMSR RLTTKTDNDRNTAVSATSSTLTSPSPTT

ASRSTVPLPSLLPDQG GISLFPYGSEVGDQNLFARTVDFNSPIFKILIGFPLGSSLRDSFY VTDNGQIIFPESDYDVFSYPNPPQRGFTGRERVAMVA

PFWADADFSSSRGAIFYQ EYVTFYNEHHQLIREVETLINDFTSSWGYRAKWTLKVTWVNVPAYTAQESFG TNTYQAILSTDGSRSYALFLYQNSGMRW

DVTQEPYNRVLMGFSS SGDGYFENSPLTFRPAMEKYRPDRFLNSKLG GIRGLQVYRLHREERPNYRLKCLQWLESQPQQPSWGWSSVSCPCSWQQGQR

DFRFRPINPG GWWDRQLCSFSSGRGGVCCSYGAWGEFREGWRMHSPWQFD DEEQEAQNWCCQWNDKPSFCVWYQLRRPRVSCAGYRPPRPA AWTFGD

PHITTLDNANFTFNGLGDFLLVQAQDRNSSFLLEGRTAQTGTAKATNFIAFAAQYNTSSLKSPIT VQWFLEPSDKIRVVYNNQTVAFNTRDTEV VLPI

FNTTGVLLTQNGSQVSANFDGTVTISVIARSNILHASSSLSEEYRNHTEGLLG GVWNDNPEDDFRMPNGSTIPSNSSEETLFYYGMTW WHVNGTGLLG

IRADPLPTKFTPIFLSQLLNQSASGEDLASGCKGDRKCMFDILATGNRTIGQSTNSILNEFQHMNDTLN NQYPPSINCSSKIQAYKGQTVTTEITSNSK

DATLSLSKKCSGFKLFE ENGSLQWTPTSPEACTLEILARDVRTNLSWVLQPKTVACFCSKEEQCLYNETSKEGNSSLEVSSGGWGRRASGGM

For any suggestions or comments, please send an email to unitrap@crg.es