Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035673 (Sbno2)
Chromosomal location
Chr 10: 79519765 - 79565447 (-)
Description
strawberry notch homolog 2 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:2448490]
RefSeq_dna
NM_183426 
RefSeq_peptide
NP_906271.1 
UniGene
Mm.262102 
MGI
MGI:2448490 
Uniprot/SWISSPROT
Q7TNB8 
Human Ortholog
ENSG00000064932 (SBNO2)
Omim not available
UniTrap UNI25092
Vector Insertion
Chr 10: 79549178 - 79565354
Public Clones not available
Private Clones OST195422 (lexicon) OST165531 (lexicon) OST57223 (lexicon) OST32722 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8749
Vector Insertion
Chr 10: 79547060 - 79549001
Public Clones XN464 (baygenomics) IST13042A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25845
Vector Insertion
Chr 10: 79545472 - 79546985
Public Clones not available
Private Clones OST158413 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1353
Vector Insertion
Chr 10: 79538185 - 79545359
Public Clones CJ0555 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37809
Vector Insertion
Chr 10: 79535101 - 79538185
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26258
Vector Insertion
Chr 10: 79521478 - 79521549
Public Clones not available
Private Clones OST128072 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31594
Vector Insertion
Chr 10: 79520700 - 79521075
Public Clones IST13980D4 (tigm) IST13062B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21826
Vector Insertion
Chr 10: 79520610 - 79520700
Public Clones not available
Private Clones OST316685 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092316
Sequence
GGAGCCGGTGACTAACCCTCATGCAAATGGGGCCGGCTAGATCTCTTCTGCCTCTGTCCCTGACGGAGCCGCCGAGCCTGCGGCTGCCGTGGTCATGAGG

CTGGTGCTCCCCAGCAGCTCTTCCAGGGGGACACGCGGCCACCACTCAGCGCCCCCGCACCCCGACCATGTCACAGCTGCGCTTCTGGCTGCAGTTCGCT

GCGCTCAACAAG GACCCCTCATGCCTCGAGGACCTCTCCAATGCCTCTGTCTTCTCTTCATCTGTGGATTCCCTGTCAGACATCCCAGACACACCTGAC

TTCCTGCAGGCTGACAGCCTCAACGAGGTGCCTACCATCTGGGATGTCAGCACCACCTCAACTACCCATGACAAG CTGTTCATACCTAGTGGGCCATTC

TCGGCTCCTGAAGACCCGGTGACTTCGCTCTCCAGCACTCCACTTCTCATCAGCTATCAG TCACACAGCCAGCCTGAGGAGGAAGAAGGGGAGGAAGAG

GAGGAGACTGAGGAACTGGGCCATGCTGAGACCTATGCTGACTATGTACCATCTAAGT CCAAGATTGGAAAGCAACACCCAGACCGTGTGGTTGAGACC

AGCACACTGTCCAGTGTTCCACCCCCGGACATCACCTACACCCTAGCGCTACCCACCTCAGACAACAGCACCCTGTCTGCCCTACAGCTGGAAGCCATCA

CCTATGCCTGCCAG CAACACGAGGTCCTGCTGCCCAGTGGGCAGCGTGCTGGTTTTCTGATTGGGGATGGGGCCGGCGTGGGCAAGGGCCGCACAGTGG

CTGGCATCATAGTGGAGAACTACCTGCGGGGCCGGAAGAAGGCATTGTG GTTCAGTGCCTCCAATGACCTCAAGTATGATGCGGAACGGGACCTGAGAG

ACATTGAGGCCCCAGGCATTGCAGTGCATGCATTGAGCAAG ATCAAGTACGGTGACAACACTACCTCAGAGGGTGTCCTCTTTGCCACCTACTCTGCCC

TGATTGGAGAAAGCCAGGCAGGTGGGCAGCATCGCACACGCCTCCGCCAGATCCTGCAGTGGTGTGGTGAGGGCTTCGATGGTGTG ATTGTGTTTGACG

AGTGCCACAAAGCCAAGAACGCCAGTTCCACTAAGATGGGCAAGGCCGTGCTGGACCTGCAGAGCAAACTGCCCCAGGCTAGGGTGGTGTACGCCAGTGC

CACAG GTGCCTCTGAGCCCCGCAACATGATATACATGAGCCGGCTGGGCATTTGGGGTGAGGGCACACCCTTCCGGACCTTTGAGGAGTTCCTGCATGC

CATTGAGAAGAG GGGCGTGGGTGCCATGGAGATCGTGGCGATGGACATGAAGGTCAGCGGCATGTACATCGCTCGCCAGCTCAGCTTCTCAGGGGTCAC

CTTCCGAATCGAGGAGATCCCGCTGTCCCCTGCCTTCCAGCAGGTCTATAATCGGGCAGCCCGGCTG TGGGCCGAGGCCCTGAGCGTGTTCCAGCAGGC

AGCTGACTGGATCGGCCTGGAGTCTCGCAAGTCCCTGTGGGGTCAGTTCTGGTCAGCGCACCAGCGCTTCTTTAAGTACCTGTGCATCGCAGCCAAAGTG

CACCGGCTAGTGGAGCTGGCACAGCAGGAGCTGAGCAGGGACAAG TGTGTGGTCATCGGGCTGCAGTCCACAGGGGAGGCACGGACTCGAGAGGTGCTG

GATGAGAACGAGGGCCGCCTGGACTGCTTCGTCTCCGCAGCAGA AGGTGTCTTCCTGTCCCTGATCCAGAAGCACTTCCCTTCCACCAGGCGGAGGCGT

GACCGCGGAGGAGGAAAGAGGAAAC GGCGGCCTCGGGGTCGTGGCCCCAAGGCTTCCAGACTGTCACTGGAGGCAGCAGGAGTTATCCGTATTAGTGAT

GGCAGCAGCACAGAGTCAGATGCTGGCCTGGATAGCGACTTCAATTCATCCCCAGAATCCCTGGTAGACGATGATGTGGTCATTGTAGACGCCCCCACAC

ACCCCACAGATGACCGAGGTGAGCCTCCATCATCCAGCCAGACTCAAGGCAGCAGACATAACCACATGAGGCCTATTCCACCAAACACCCTTGTTACAGA

TGGGGAAACTGAGACTCACAGCCAAGGTCAGGGCTATGCTATCAAATAAAACAGAGTGACTGCTGTTGT
Translation
MSQLRFWLQFAALNK DPSCLEDLSNASVFSSSVDSLSDIPDTPDFLQADSLNEVPTIWDVSTTSTTHDK LFIPSGPFSAPEDPVTSLSSTPLLISYQ 

SHSQPEEEEGEEEEETEELGHAETYADYVPSKS SKIGKQHPDRVVETSTLSSVPPPDITYTLALPTSDNSTLSALQLEAITYACQ QHEVLLPSGQRAG

FLIGDGAGVGKGRTVAGIIVENYLRGRKKALW WFSASNDLKYDAERDLRDIEAPGIAVHALSK IKYGDNTTSEGVLFATYSALIGESQAGGQHRTRLR

QILQWCGEGFDGV IVFDECHKAKNASSTKMGKAVLDLQSKLPQARVVYASATG GASEPRNMIYMSRLGIWGEGTPFRTFEEFLHAIEKR RGVGAMEI

VAMDMKVSGMYIARQLSFSGVTFRIEEIPLSPAFQQVYNRAARL WAEALSVFQQAADWIGLESRKSLWGQFWSAHQRFFKYLCIAAKVHRLVELAQQEL

SRDK CVVIGLQSTGEARTREVLDENEGRLDCFVSAAE EGVFLSLIQKHFPSTRRRRDRGGGKRKR RRPRGRGPKASRLSLEAAGVIRISDGSSTESD

AGLDSDFNSSPESLVDDDVVIVDAPTHPTDDRGEPPSSSQTQGSRHNHMRPIPPNTLVTDGETETHSQGQGYAIK
Transcript ENSMUST00000042771
Sequence
CGGCAACATGGCGCCCAGAACCCGGAAGTGAGCGGCGGCCGCTGAGAGGCTCCGGGAAACCGAGGCGTCGCGGGCTCAGCGATCAGGTCTGAG - UNI2

5092 - GATATGACATTACAACTGCCGCTGCCAGCACCACAGAGTAAGCAGTCCAGATAGCCGCCACCCGAGGGTCGCGGAGCGCTGCCTCCACTTGCC

TGATGCTGGCAGTGGAACCCACCATGGATGGGGACTTCCCTCCACATGAGCTCCCACCCCCTGGAGGTGGCATCCAGCTACAG - UNI8749 - AACC

GACTCCTGCACTGTCCTTGGTGGGGCAGTTTCTCACCGTCTTTGTACCCCACCTTCTCCAGTGAAAACCA - UNI25845 - ACAGTTCGTGGGTTCC

ACCCCATTCCTTGGTGGCCAGTCTTGCCCTGAAACCAGCTACCCCACCACAGCCACCGTCCCCAGCTTCTTCTCCAAGAGCAGCGACTTTCCTCAG - U

NI1353 - GACCCCTCATGCCTCGAGGACCTCTCCAATGCCTCTGTCTTCTCTTCATCTGTGGATTCCCTGTCAGACATCCCAGACACACCTGACTTCC

TGCAGGCTGACAGCCTCAACGAGGTGCCTACCATCTGGGATGTCAGCACCACCTCAACTACCCATGACAAG CTGTTCATACCTAGTGGGCCATTCTCGG

CTCCTGAAGACCCGGTGACTTCGCTCTCCAGCACTCCACTTCTCATCAGCTATCAG TCACACAGCCAGCCTGAGGAGGAAGAAGGGGAGGAAGAGGAGG

AGACTGAGGAACTGGGCCATGCTGAGACCTATGCTGACTATGTACCATCTAAGT CCAAGATTGGAAAGCAACACCCAGACCGTGTGGTTGAGACCAGCA

CACTGTCCAGTGTTCCACCCCCGGACATCACCTACACCCTAGCGCTACCCACCTCAGACAACAGCACCCTGTCTGCCCTACAGCTGGAAGCCATCACCTA

TGCCTGCCAG CAACACGAGGTCCTGCTGCCCAGTGGGCAGCGTGCTGGTTTTCTGATTGGGGATGGGGCCGGCGTGGGCAAGGGCCGCACAGTGGCTGG

CATCATAGTGGAGAACTACCTGCGGGGCCGGAAGAAGGCATTGTG GTTCAGTGCCTCCAATGACCTCAAGTATGATGCGGAACGGGACCTGAGAGACAT

TGAGGCCCCAGGCATTGCAGTGCATGCATTGAGCAAG ATCAAGTACGGTGACAACACTACCTCAGAGGGTGTCCTCTTTGCCACCTACTCTGCCCTGAT

TGGAGAAAGCCAGGCAGGTGGGCAGCATCGCACACGCCTCCGCCAGATCCTGCAGTGGTGTGGTGAGGGCTTCGATGGTGTG ATTGTGTTTGACGAGTG

CCACAAAGCCAAGAACGCCAGTTCCACTAAGATGGGCAAGGCCGTGCTGGACCTGCAGAGCAAACTGCCCCAGGCTAGGGTGGTGTACGCCAGTGCCACA

G GTGCCTCTGAGCCCCGCAACATGATATACATGAGCCGGCTGGGCATTTGGGGTGAGGGCACACCCTTCCGGACCTTTGAGGAGTTCCTGCATGCCATT

GAGAAGAG GGGCGTGGGTGCCATGGAGATCGTGGCGATGGACATGAAGGTCAGCGGCATGTACATCGCTCGCCAGCTCAGCTTCTCAGGGGTCACCTTC

CGAATCGAGGAGATCCCGCTGTCCCCTGCCTTCCAGCAGGTCTATAATCGGGCAGCCCGGCTG TGGGCCGAGGCCCTGAGCGTGTTCCAGCAGGCAGCT

GACTGGATCGGCCTGGAGTCTCGCAAGTCCCTGTGGGGTCAGTTCTGGTCAGCGCACCAGCGCTTCTTTAAGTACCTGTGCATCGCAGCCAAAGTGCACC

GGCTAGTGGAGCTGGCACAGCAGGAGCTGAGCAGGGACAAG TGTGTGGTCATCGGGCTGCAGTCCACAGGGGAGGCACGGACTCGAGAGGTGCTGGATG

AGAACGAGGGCCGCCTGGACTGCTTCGTCTCCGCAGCAGA AGGTGTCTTCCTGTCCCTGATCCAGAAGCACTTCCCTTCCACCAGGCGGAGGCGTGACC

GCGGAGGAGGAAAGAGGAAAC GGCGGCCTCGGGGTCGTGGCCCCAAGGCTTCCAGACTGTCACTGGAGGCAGCAGGAGTTATCCGTATTAGTGATGGCA

GCAGCACAGAGTCAGATGCTGGCCTGGATAGCGACTTCAATTCATCCCCAGAATCCCTGGTAGACGATGATGTGGTCATTGTAGACGCCCCCACACACCC

CACAGATGACCGAG GTTCCCTGTACCCACTTCAGAGAGACCTGCAGGGCCCTGGTGTCGTGGAACGGGTAGAACGGCTGAAACAGGGTCTGCTTGCCAA

GGTGCGAGCGCTGGGCCGGGAGCTGCCAGTCAACACGTTGGACCAGCTCATCCACCAACTTGGGGGTCCTGAGTGTGTGGCCGAG ATGACCGGCAGGAA

AGGCCGAGTGGTATCGAGGCCTGATGGGACAGTGGTCTTTGAGTCCAGAGCAGAACAGGGCCTGTCCATCGACCATGTGAACCTCAGGGAGAAGCAGCGC

TTCATGAGCGGCGAGAAG CTCGTGGCTATTATCTCTGAGGCCTCCAGCTCAGGTGTCTCCCTCCAAGCCGACCGTCGAGTCCAGAACCAGCGGCGCCGG

GTACACATGACCCTGGAGCTGCCTTGGAGTGCAGACCGTGCCATTCAACAGTTTG GCCGCACCCACAGGTCCAACCAGGTCTCAGCACCCGAGTACGTC

TTCCTTATCTCAGAACTGGCAGGGGAGCGCAGGTTTGCCTCCATTGTGGCCAAGCGGCTCGAAAGTCTG GGTGCCCTCACCCATGGAGATCGCCGCGCC

ACTGAGTCCCGAGACCTGAGCAAGTACAACTTTGAGAACAAG TATGGCGCCCGTGCGCTCAGCCGCGTCCTTGCTACAATCATGGGCCAGACGGACAAC

AGGGTGCCCCTGCCCCAGGGCTATCCAGGAGGGGATACCGCCTTCTTTCGGG ACATGAAGCAGGGCCTGCTGTCTGTGGGCATCGGCAGCCGGGAGTCA

CGCTCGGGCTGCTTGGATGTGGAGAAGG ACTGCTCCATCACCAAGTTCCTGAACCGCATCCTTGGGCTGGAGGTGCACAAGCAGAACGCCCTGTTCCAA

TACTTCTCCGACACCTTCGACCACCTCATCGAGATCGACAAGAAGGAGGGCAGATACGACATGGGCATCCTAG ACCTGGCCCCTGGCATCAACGAGATA

CATGAAGAAAGCCAGCAGGTGTTCCTGGCACCTGGGCACCCACAGGATGGGCAAGTGGTCTTCTACAAG - UNI26258 - CAGATTAGCGTGGACCG

CGGTATGAAGTGGGAAGAGGCATTAACTAGGTCGCTGGAGCTCAAAGGTCCCTATGATGGCTTCTACCTCTCCTACAAG GTACGAGGCAGCAAAATGAG

CTGCCTCCTGGCAGAACAGAATCGCGGCGAGTATTTCACCGTGTACAAGCCAAACATCGGCAGACAGAGCCAGCTGGAGACCCTGGACAGCCTGTGCCGG

AAGTTTCACCGG - UNI31594 - GTCACTGTGGAAGAGGCCCGGGAACCCTGGGAGAGCAGCTATGCCCTGTCCTTGGAGCACTGCAGTCACACCAC

CTG - UNI31594 - GAACCAGCGCTGCAGACTGACACAGGAGGGCAAGTGCTGCGCCCAGGGCCTGCGCCTCCGCCACCACTACATGCTGTGTGGGG

CGCTGCTGCGTGTGTGGGGCCGCATCGCCGCTGTCATGGCGGATGTCAGCAGTAGCAGCTACCTACAGATTGTGCGCCTTAAGACCAAGGACAAGAAGAA

GCAAGTGG - UNI21826 - - UNI31594 - GCATCAAGATCCCCGAGGGATGCGTTCACCGCGTACTGCAGGAACTGCAGCTGATGGATGCAGAA

GTGAAGCGCCGCAGCACCCATGGGTTGGCAGCGCGCCCACCCACTCCACGTGCGATTACGCTTCCTTGCGGTCCGGGTGAGGTGCTGGACTTGACCTACA

GTCCCCCAGCTGAGGCTTTCCCAACACCTCCGCGCTTCGCCTTCCCTTCGCTGCCGCCCCCAGACCCCAGCTCTCTGATGCTGGGTGCTAGAGACCCTGC

TACCAACCCTGTGGAGCTGGCACACCAGAGCTGCGACATCAATTTCAGGGAAGTGTTGGAAGACATGCTCCGCTCTTTGCGCGCGGGACCCACCGAAACC

CCTGCACCTCTGGTGGGCGTGGGTGGCGGGGGCACAGAGCGACAGAGCGTCATCCACTTCAGCCCACCCTTCCCAAACTCTTAGGCTGCTACTTCAGCCT

CTGGATTACAACTGTACTGGGCAGCAAGGCCTATGGGCTCCTCTGCAAGCAGAGGCTCCCATGACTACTGAGGTGCCTGGCCACAGTGCCTTCCCAGCCA

GTGGGGAGTGGGGCCTCTCTGTGCCTCACCTGCTACAGCTGCGCAGCCTAGAAGCCGTGGGGCTTGGTTGTCCCAGAGAGCTGGTAACTCAGGAAATCGG

TGCTCGGGCCCCGCTGGCTATGGGGGCTCCACGGGGCAGACCCCGTTAATATATGCAATCCCCTGCTCCCTAAATTATTGTCACCCGCCTCTCCCCAGCC

CCGGAGTCTGTGGGCAGCCGGCGGGCCCTGGTTTCTATGTATTTATAATGAACTCGTGTACATATGTAAAGATCTTTTTT
Translation
 - UNI25092 - MLAVEPTMDGDFPPHELPPPGGGIQLQ - UNI8749 - NRLLHCPWWGSFSPSLYPTFSSENQ - UNI25845 - QQFVGST

PFLGGQSCPETSYPTTATVPSFFSKSSDFPQ - UNI1353 - DPSCLEDLSNASVFSSSVDSLSDIPDTPDFLQADSLNEVPTIWDVSTTSTTHDK L

FIPSGPFSAPEDPVTSLSSTPLLISYQ SHSQPEEEEGEEEEETEELGHAETYADYVPSKS SKIGKQHPDRVVETSTLSSVPPPDITYTLALPTSDNST

LSALQLEAITYACQ QHEVLLPSGQRAGFLIGDGAGVGKGRTVAGIIVENYLRGRKKALW WFSASNDLKYDAERDLRDIEAPGIAVHALSK IKYGDNT

TSEGVLFATYSALIGESQAGGQHRTRLRQILQWCGEGFDGV IVFDECHKAKNASSTKMGKAVLDLQSKLPQARVVYASATG GASEPRNMIYMSRLGIW

GEGTPFRTFEEFLHAIEKR RGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLSPAFQQVYNRAARL WAEALSVFQQAADWIGLESRKSLWGQF

WSAHQRFFKYLCIAAKVHRLVELAQQELSRDK CVVIGLQSTGEARTREVLDENEGRLDCFVSAAE EGVFLSLIQKHFPSTRRRRDRGGGKRKR RRPR

GRGPKASRLSLEAAGVIRISDGSSTESDAGLDSDFNSSPESLVDDDVVIVDAPTHPTDDRG GSLYPLQRDLQGPGVVERVERLKQGLLAKVRALGRELP

VNTLDQLIHQLGGPECVAE MTGRKGRVVSRPDGTVVFESRAEQGLSIDHVNLREKQRFMSGEK LVAIISEASSSGVSLQADRRVQNQRRRVHMTLELP

WSADRAIQQFG GRTHRSNQVSAPEYVFLISELAGERRFASIVAKRLESL GALTHGDRRATESRDLSKYNFENK YGARALSRVLATIMGQTDNRVPLP

QGYPGGDTAFFRD DMKQGLLSVGIGSRESRSGCLDVEKD DCSITKFLNRILGLEVHKQNALFQYFSDTFDHLIEIDKKEGRYDMGILD DLAPGINEI

HEESQQVFLAPGHPQDGQVVFYK - UNI26258 - QISVDRGMKWEEALTRSLELKGPYDGFYLSYK VRGSKMSCLLAEQNRGEYFTVYKPNIGRQS

QLETLDSLCRKFHR - UNI31594 - VTVEEAREPWESSYALSLEHCSHTTW - UNI31594 - WNQRCRLTQEGKCCAQGLRLRHHYMLCGALLR

VWGRIAAVMADVSSSSYLQIVRLKTKDKKKQVG - UNI21826 - - UNI31594 - GIKIPEGCVHRVLQELQLMDAEVKRRSTHGLAARPPTPRA

ITLPCGPGEVLDLTYSPPAEAFPTPPRFAFPSLPPPDPSSLMLGARDPATNPVELAHQSCDINFREVLEDMLRSLRAGPTETPAPLVGVGGGGTERQSVI

HFSPPFPNS

For any suggestions or comments, please send an email to unitrap@crg.es