Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035683 (Melk)
Chromosomal location
Chr 4: 44313822 - 44377154 (+)
Description
maternal embryonic leucine zipper kinase Gene [Source:MGI (curated);Acc:Melk-001]
RefSeq_dna
NM_010790 
RefSeq_peptide
NP_034920.2 
MGI
MGI:106924 
Uniprot/SWISSPROT
Q61846 
Uniprot/SPTREMBL
A2ALQ9 A2ALR0 Q3TJF3 Q3TPU1 Q3TU15 Q3UMB0 Q5U440 
Human Ortholog
ENSG00000165304 (MELK)
Omim not available
UniTrap UNI19365
Vector Insertion
Chr 4: 44313945 - 44316442
Public Clones not available
Private Clones OST393373 (lexicon) OST358326 (lexicon) OST182842 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1684
Vector Insertion
Chr 4: 44330895 - 44330995
Public Clones CF0813 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3997
Vector Insertion
Chr 4: 44357896 - 44359995
Public Clones AR0181 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107828
Sequence
GAACTTGAATCCTGCAGAAATTCCCACCGACTTGTTCCGGCTTTGCTAGACTCTGCAGCCGGCTGCTTCACCTTCTGTCCTGTTCGGTCCTGTTCGGTCC

TTGCTGGGCCCGCTGCCCTTCAG - UNI19365 - GTTCTGGTTGTCATTTTGAATAACCTTCCAGGTGGACTATGAAAGATTATGACGAACTCCTCA

AATACTATGAACTATATGAAACGATTGGGACAG GTGGCTTTGCAAAGGTCAAACTGGCCTGCCATGTCCTCACTGGAGAGATGGTAGCTATAAAAATCA

TGGATAAGAATGCGCTAGGG AGTGATTTGCCCCGAGTCAAAACTGAGATCGATGCGCTGAAGAGTCTGAGACATCAGCACATATGTCAGCTCTACCATG

TGCTGGAGACAAAGAACAAAATATTCATGGTTCTGGAG GGCAACAAGGACTACCATCTGCAGACGTGCTGTGGGAGCCTTGCTTATGCAGCTCCTGAAC

TAATACAAGGGAAGTCGTACCTTGGATCAGAG - UNI1684 - GCAGATGTTTGGAGCATGGGCATCCTCCTGTATGTGCTCATGTGTGGATTTCTAC

CATTTGATGATGATAATGTCATGGCTTTGTACAAGAAGATAATG - UNI1684 - AGAGGGAAATACGAAGTTCCTAAGTGGCTCTCTCCCAGTAGCA

TTCTGCTTCTCCAGCAGATGTTGCAG GTGGACCCAAAGAAACGGATTTCTATGAGAAATCTCCTGAACCATCCCTGGGTCATGCAAGATTACAGCTGTC

CCGTGGAGTGGCAAAGCAAGACTCCT TTGACTCACCTCGATGAGGATTGCGTGACAGAGCTTTCTGTACATCACCGCAGCAGCAGGCAGACAATGGAGG

ATTTAATTTCGTCG TGGCAGTACGATCACCTCACAGCCACCTACCTTCTGCTTCTAGCCAAGAAGGCCCGGGGGAAGCCGGCTCGTCTACAGCTCCTGT

CCTTCTCTTGTGGAACCGCCAGCACCACTCCAAAG TCAAAGAATCTGAGCCTGGAAGATATGAGCACAAGTGATGATAACTGTGTGGCTGGATTGATAG

ACTATGAATTGTGTGAAGATAAATTATTAGCTCCCAAGACGCCACAG - UNI3997 - GTTACCAAACACTTGGCAGAATCAAATCACGCAGCATCTA

AATCACCAGCGCCAGGGGTACGCAGAGCAGTGGCAAATAAATTAATGGACAAAGAAAATGTGTGCACTCCCAAGTCTTCTGTGAAGAATGAAGAGCAGTT

TGTATTTTCTGAGCCGAAGATTCCAGTTAGTAAGAACCAGTATAAGAGAGAAATACCCGCCTCACCAACCCGTTTCCCAACACCTGCAAAAG CTAGAGC

CCAGTGCCTGAGAGAAGCCCCGGTTAGAACACCAGGGAATTCCGCAGGAGCAGACACACTAACGACAGGTGTCATTAGCCCCGAGAGGAG GTGCCGTTC

AATGGACGTGGATCTCAACCAGGCACACATGGAGGATACCCCGAAAAAGAAAGGAACCAATGTGTTTGGGAGCCTTGAGAGAGGACTGGATAAGGTTCTC

ACTGCGCTCACAAGGAACAAGAAGAAGGGCTCTGCCAGAGATGGACCAAGAAAGCGAAAG CTGCACTACAATGTGACTACAACTCGCCTGGTGAACCCC

GACCAGCTCCTGAGCGAAATCATGGCTATTCTTCCAAAGAAGAACGTGGACTTCGTACAGAAAGG TTACACTCTAAAGTGTCAAACGCAGTCTGATTTT

GGCAAAGTGACAATGCAGTTTGAACTGGAAGTGTGCCAGCTGCAGAGACCTGACGTGGTAGGCATCCGGAGACAGCGGCTGAAGGGTGATGCCTGGGTTT

ACAAGAGATTAGTGGAAGATATCTTGTCTGGCTGCAAGATGTGACCGATGACAGTGTCCGTCTGCCCGGATGAATGTGGGTGTGATGTTGCACACAGGAA

GACTGTGAGATTGGTTCCATTTGGGGGCCATTGGATCTATGGAACTACAAGCTCATTTAAATAGCCATCTTCAAGACCAATGTATTTTTGCTTTTTAAAC

AAAAATTTTTACTTTGTGGCTGAATCCAAGGCAACTGTTCTGTCATTATCAATTACTCTCTGTTTTAATCATGGGCTTGGTATGTTAGTAACTGTTTTTA

TATTCACTTCCATCAGGGGATGCCAGCTCTTCACTGTGACTCATTTTGATGTACAGTTTCTTTCTGAACTAAAACCATTTGTGAATATATCAAGCTCTTT

TTTGTATCTGATTTTGATCCAAATAAAACCTCGAATGGC
Translation
 - UNI19365 - MKDYDELLKYYELYETIGTG GGFAKVKLACHVLTGEMVAIKIMDKNALG SDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIF

MVLE GNKDYHLQTCCGSLAYAAPELIQGKSYLGSE - UNI1684 - ADVWSMGILLYVLMCG - UNI1684 -      - UNI3997 -     
Transcript ENSMUST00000102933
Sequence
GAACTTGAATCCTGCAGAAATTCCCACCGACTTGTTCCGGCTTTGCTAGACTCTGCAGCCGGCTGCTTCACCTTCTGTCCTGTTCGGTCCTGTTCGGTCC

TTGCTGGGCCCGCTGCCCTTCAG - UNI19365 - GTTCTGGTTGTCATTTTGAATAACCTTCCAGGTGGACTATGAAAGATTATGACGAACTCCTCA

AATACTATGAACTATATGAAACGATTGGGACAG GTGGCTTTGCAAAGGTCAAACTGGCCTGCCATGTCCTCACTGGAGAGATGGTAGCTATAAAAATCA

TGGATAAGAATGCGCTAGGG AGTGATTTGCCCCGAGTCAAAACTGAGATCGATGCGCTGAAGAGTCTGAGACATCAGCACATATGTCAGCTCTACCATG

TGCTGGAGACAAAGAACAAAATATTCATGGTTCTGGAG GAAAATTTATTATTTGATGAAAATCATAAGCTAAAGCTGATTGACTTTGGTCTTTGTGCAA

AACCCAAG GGCAACAAGGACTACCATCTGCAGACGTGCTGTGGGAGCCTTGCTTATGCAGCTCCTGAACTAATACAAGGGAAGTCGTACCTTGGATCAG

AG - UNI1684 - GCAGATGTTTGGAGCATGGGCATCCTCCTGTATGTGCTCATGTGTGGATTTCTACCATTTGATGATGATAATGTCATGGCTTTGT

ACAAGAAGATAATG - UNI1684 - AGAGGGAAATACGAAGTTCCTAAGTGGCTCTCTCCCAGTAGCATTCTGCTTCTCCAGCAGATGTTGCAG GTG

GACCCAAAGAAACGGATTTCTATGAGAAATCTCCTGAACCATCCCTGGGTCATGCAAGATTACAGCTGTCCCGTGGAGTGGCAAAGCAAGACTCCT TTG

ACTCACCTCGATGAGGATTGCGTGACAGAGCTTTCTGTACATCACCGCAGCAGCAGGCAGACAATGGAGGATTTAATTTCGTCG TGGCAGTACGATCAC

CTCACAGCCACCTACCTTCTGCTTCTAGCCAAGAAGGCCCGGGGGAAGCCGGCTCGTCTACAGCTCCTGTCCTTCTCTTGTGGAACCGCCAGCACCACTC

CAAAG TCAAAGAATCTGAGCCTGGAAGATATGAGCACAAGTGATGATAACTGTGTGGCTGGATTGATAGACTATGAATTGTGTGAAGATAAATTATTAG

CTCCCAAGACGCCACAG - UNI3997 - GTTACCAAACACTTGGCAGAATCAAATCACGCAGCATCTAAATCACCAGCGCCAGGGGTACGCAGAGCAG

TGGCAAATAAATTAATGGACAAAGAAAATGTGTGCACTCCCAAGTCTTCTGTGAAGAATGAAGAGCAGTTTGTATTTTCTGAGCCGAAGATTCCAGTTAG

TAAGAACCAGTATAAGAGAGAAATACCCGCCTCACCAACCCGTTTCCCAACACCTGCAAAAG CTAGAGCCCAGTGCCTGAGAGAAGCCCCGGTTAGAAC

ACCAGGGAATTCCGCAGGAGCAGACACACTAACGACAGGTGTCATTAGCCCCGAGAGGAG GTGCCGTTCAATGGACGTGGATCTCAACCAGGCACACAT

GGAGGATACCCCGAAAAAGAAAGGAACCAATGTGTTTGGGAGCCTTGAGAGAGGACTGGATAAGGTTCTCACTGCGCTCACAAGGAACAAGAAGAAGGGC

TCTGCCAGAGATGGACCAAGAAAGCGAAAG CTGCACTACAATGTGACTACAACTCGCCTGGTGAACCCCGACCAGCTCCTGAGCGAAATCATGGCTATT

CTTCCAAAGAAGAACGTGGACTTCGTACAGAAAGG TTACACTCTAAAGTGTCAAACGCAGTCTGATTTTGGCAAAGTGACAATGCAGTTTGAACTGGAA

GTGTGCCAGCTGCAGAGACCTGACGTGGTAGGCATCCGGAGACAGCGGCTGAAGGGTGATGCCTGGGTTTACAAGAGATTAGTGGAAGATATCTTGTCTG

GCTGCAAGATGTGACCGATGACAGTGTCCGTCTGCCCGGATGAATGTGGGTGTGATGTTGCACACAGGAAGACTGTGAGATTGGTTCCATTTGGGGGCCA

TTGGATCTATGGAACTACAAGCTCATTTAAATAGCCATCTTCAAGACCAATGTATTTTTGCTTTTTAAACAAAAATTTTTACTTTGTGGCTGAATCCAAG

GCAACTGTTCTGTCATTATCAATTACTCTCTGTTTTAATCATGGGCTTGGTATGTTAGTAACTGTTTTTATATTCACTTCCATCAGGGGATGCCAGCTCT

TCACTGTGACTCATTTTGATGTACAGTTTCTTTCTGAACTAAAACCATTTGTGAATATATCAAGCTCTTTTTTGTATCTGATTTTGATCCAAATAAAACC

TCGAATGGC
Translation
 - UNI19365 - MKDYDELLKYYELYETIGTG GGFAKVKLACHVLTGEMVAIKIMDKNALG SDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIF

MVLE ENLLFDENHKLKLIDFGLCAKPK GNKDYHLQTCCGSLAYAAPELIQGKSYLGSE - UNI1684 - ADVWSMGILLYVLMCGFLPFDDDNVMA

LYKKIM - UNI1684 - RGKYEVPKWLSPSSILLLQQMLQ VDPKKRISMRNLLNHPWV    - UNI3997 -     
Transcript ENSMUST00000045607
Sequence
GAACTTGAATCCTGCAGAAATTCCCACCGACTTGTTCCGGCTTTGCTAGACTCTGCAGCCGGCTGCTTCACCTTCTGTCCTGTTCGGTCCTGTTCGGTCC

TTGCTGGGCCCGCTGCCCTTCAG - UNI19365 - GTTCTGGTTGTCATTTTGAATAACCTTCCAGGTGGACTATGAAAGATTATGACGAACTCCTCA

AATACTATGAACTATATGAAACGATTGGGACAG GTGGCTTTGCAAAGGTCAAACTGGCCTGCCATGTCCTCACTGGAGAGATGGTAGCTATAAAAATCA

TGGATAAGAATGCGCTAGGG AGTGATTTGCCCCGAGTCAAAACTGAGATCGATGCGCTGAAGAGTCTGAGACATCAGCACATATGTCAGCTCTACCATG

TGCTGGAGACAAAGAACAAAATATTCATGGTTCTGGAG TACTGTCCAGGAGGAGAGCTGTTTGACTACATAATCTCCCAGGATCGCCTGTCGGAAGAGG

AGACCCGGGTCGTCTTCCGTCAGATACTGTCTGCAGTTGCGTATGTCCACAGCCAGGGCTATGCCCACAGGGACCTCAAACCA GAAAATTTATTATTTG

ATGAAAATCATAAGCTAAAGCTGATTGACTTTGGTCTTTGTGCAAAACCCAAG GGCAACAAGGACTACCATCTGCAGACGTGCTGTGGGAGCCTTGCTT

ATGCAGCTCCTGAACTAATACAAGGGAAGTCGTACCTTGGATCAGAG - UNI1684 - GCAGATGTTTGGAGCATGGGCATCCTCCTGTATGTGCTCA

TGTGTGGATTTCTACCATTTGATGATGATAATGTCATGGCTTTGTACAAGAAGATAATG - UNI1684 - AGAGGGAAATACGAAGTTCCTAAGTGGC

TCTCTCCCAGTAGCATTCTGCTTCTCCAGCAGATGTTGCAG GTGGACCCAAAGAAACGGATTTCTATGAGAAATCTCCTGAACCATCCCTGGGTCATGC

AAGATTACAGCTGTCCCGTGGAGTGGCAAAGCAAGACTCCT TTGACTCACCTCGATGAGGATTGCGTGACAGAGCTTTCTGTACATCACCGCAGCAGCA

GGCAGACAATGGAGGATTTAATTTCGTCG TGGCAGTACGATCACCTCACAGCCACCTACCTTCTGCTTCTAGCCAAGAAGGCCCGGGGGAAGCCGGCTC

GTCTACAGCTCCTGTCCTTCTCTTGTGGAACCGCCAGCACCACTCCAAAG TCAAAGAATCTGAGCCTGGAAGATATGAGCACAAGTGATGATAACTGTG

TGGCTGGATTGATAGACTATGAATTGTGTGAAGATAAATTATTAGCTCCCAAGACGCCACAG - UNI3997 - GTTACCAAACACTTGGCAGAATCAA

ATCACGCAGCATCTAAATCACCAGCGCCAGGGGTACGCAGAGCAGTGGCAAATAAATTAATGGACAAAGAAAATGTGTGCACTCCCAAGTCTTCTGTGAA

GAATGAAGAGCAGTTTGTATTTTCTGAGCCGAAGATTCCAGTTAGTAAGAACCAGTATAAGAGAGAAATACCCGCCTCACCAACCCGTTTCCCAACACCT

GCAAAAG CTAGAGCCCAGTGCCTGAGAGAAGCCCCGGTTAGAACACCAGGGAATTCCGCAGGAGCAGACACACTAACGACAGGTGTCATTAGCCCCGAG

AGGAG GTGCCGTTCAATGGACGTGGATCTCAACCAGGCACACATGGAGGATACCCCGAAAAAGAAAGGAACCAATGTGTTTGGGAGCCTTGAGAGAGGA

CTGGATAAGGTTCTCACTGCGCTCACAAGGAACAAGAAGAAGGGCTCTGCCAGAGATGGACCAAGAAAGCGAAAG CTGCACTACAATGTGACTACAACT

CGCCTGGTGAACCCCGACCAGCTCCTGAGCGAAATCATGGCTATTCTTCCAAAGAAGAACGTGGACTTCGTACAGAAAGG TTACACTCTAAAGTGTCAA

ACGCAGTCTGATTTTGGCAAAGTGACAATGCAGTTTGAACTGGAAGTGTGCCAGCTGCAGAGACCTGACGTGGTAGGCATCCGGAGACAGCGGCTGAAGG

GTGATGCCTGGGTTTACAAGAGATTAGTGGAAGATATCTTGTCTGGCTGCAAGATGTGACCGATGACAGTGTCCGTCTGCCCGGATGAATGTGGGTGTGA

TGTTGCACACAGGAAGACTGTGAGATTGGTTCCATTTGGGGGCCATTGGATCTATGGAACTACAAGCTCATTTAAATAGCCATCTTCAAGACCAATGTAT

TTTTGCTTTTTAAACAAAAATTTTTACTTTGTGGCTGAATCCAAGGCAACTGTTCTGTCATTATCAATTACTCTCTGTTTTAATCATGGGCTTGGTATGT

TAGTAACTGTTTTTATATTCACTTCCATCAGGGGATGCCAGCTCTTCACTGTGACTCATTTTGATGTACAGTTTCTTTCTGAACTAAAACCATTTGTGAA

TATATCAAGCTCTTTTTTGTATCTGATTTTGATCCAAATAAAACCTCGAATGGC
Translation
 - UNI19365 - MKDYDELLKYYELYETIGTG GGFAKVKLACHVLTGEMVAIKIMDKNALG SDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIF

MVLE YCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKP ENLLFDENHKLKLIDFGLCAKPK GNKDYHLQTCCGSLAYAAPELI

QGKSYLGSE - UNI1684 - ADVWSMGILLYVLMCGFLPFDDDNVMALYKKIM - UNI1684 - RGKYEVPKWLSPSSILLLQQMLQ VDPKKRIS

MRNLLNHPWVMQDYSCPVEWQSKTP LTHLDEDCVTELSVHHRSSRQTMEDLISS WQYDHLTATYLLLLAKKARGKPARLQLLSFSCGTASTTPK SKN

LSLEDMSTSDDNCVAGLIDYELCEDKLLAPKTPQ - UNI3997 - VTKHLAESNHAASKSPAPGVRRAVANKLMDKENVCTPKSSVKNEEQFVFSEPK

IPVSKNQYKREIPASPTRFPTPAKA ARAQCLREAPVRTPGNSAGADTLTTGVISPERR RCRSMDVDLNQAHMEDTPKKKGTNVFGSLERGLDKVLTAL

TRNKKKGSARDGPRKRK LHYNVTTTRLVNPDQLLSEIMAILPKKNVDFVQKG GYTLKCQTQSDFGKVTMQFELEVCQLQRPDVVGIRRQRLKGDAWVY

KRLVEDILSGCKM

For any suggestions or comments, please send an email to unitrap@crg.es