Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035696 (Rnf38)
Chromosomal location
Chr 4: 44139085 - 44181211 (-)
Description
ring finger protein 38 Gene [Source:MGI (curated);Acc:Rnf38-017]
RefSeq_dna
NM_001038993 NM_175201 
RefSeq_peptide
NP_001034082.1 NP_780410.2 
UniGene
Mm.418420 Mm.262859 
MGI
MGI:1920719 
Uniprot/SWISSPROT
Q8BI21 
Uniprot/SPTREMBL
B1AWE7 B1AWE8 B1AWE9 Q3UH35 A2ALQ7 
Human Ortholog
ENSG00000137075 (RNF38)
Omim not available
UniTrap UNI14270
Vector Insertion
Chr 4: 44171774 - 44180388
Public Clones FHCRC-GT-S21-3D1 (fhcrc) IST13546B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19451
Vector Insertion
Chr 4: 44165231 - 44165426
Public Clones not available
Private Clones OST390961 (lexicon) OST275985 (lexicon) OST240345 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3257
Vector Insertion
Chr 4: 44142529 - 44144415
Public Clones AK0251 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107836
Sequence
CTACCATTCAAGAGGATGCTCACTTCAAAGCTTTCTTCCAG - UNI14270 - GCCCATCTAATAATTCAGTCGTTTTCTGAGTTTGGTTCTAGTAGC

ACCAAGTGTCACTGGGAATCTTACATCAGAAGTAGCAATTCATATTAG - UNI19451 - AGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTC

TCATTCAGTCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCAATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGACCA

AATCAACATCACTTCTCAGGGGAACGCTGTAACACACCTGCACGCAACAGAAGAAG - UNI19451 - TCCTCCTGTTAGGCGTCAGCGAGGAAGAAG

GGAACGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAACTATCACCATCTCCCTTATGCACAGCAGCAAGCAATAGAGGAACCTCGAGCCTTCCAC

CCTCCGAATGTATCTCCCCGTCTGTTACATCCAGCTGCCCATCCCCCCCAGCAGAATGCAGTCATGGTTGACATACATGATCAG CTCCATCAAGGAACA

GTTCCTGTCTCCTACACGGTAACTACGGTGGCACCCCATGGGCTTCCACTCTGCACTGGCCAGCACATCCCTGCTTGCAGTACACAGCAGGTCCCAGGAT

GCTCGGTGGTTTTCAGTGGACAACACCTCCCCGTCTGTAGTGTGCCTCCTCCA ATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCATATGCTG

CGTTCCCGCCCCTCATTTCTAGCGATCCGTTTCTTATACATCCTCCTCATCTTTCTCCCCATCATCCTCCCCACTTGCCACCACCAGGCCAATTTGTCCC

TTTCCAAACACAGCAGTCACGATCG CCTCTGCAGAGGATAGAAAATGAAGTGGAGCTCTTAGGAGAACATCTTCAAGTAGGCAGTTTTACTTATCCCCC

TTCAGCCCATCCCCCAACATTACCTCCGTCAGCTCCTTTGCAGTTCCTGACACATGACCCTTTGCATCAGGAGGTGTCCTTTGGAGTA CCTTACCCACC

ATTTATGCCTCGGAGACTCACAGGACGTAGTAGATACCGATCCCAGCAGCCAATGCCCCCTCCTCCTTACCATCCCAGCTTACTACCATACGTGCT ATC

AATGCTTCCAGTACCACCTGCAGTGGGCCCAACCTTCAGCTTTGAATTAGATGTAGAAGACGGAGAAGTTGAAAATTATGAG GCCCTGTTAAACTTGGC

GGAGAGACTGGGAGAGGCGAAACCTCGGGGACTGACTAAAGCAGATATTGAACAGCTTCCTTCGTACAGGTTCAATCCTAGCAACCACCAGTCAGAGCAG

ACTTT GTGTGTAGTATGCATGTGTGATTTTGAGTCAAGGCAGCTTCTTAGAGTCTTACCTTGTAACCACGAGTTCCATGCCAAGTGTGTTGATAAATGG

CTTAAG - UNI3257 - GGAAACCGTACCTGCCCAATTTGCCGAGCTGATGCTTCAGAAGTGCATCGCGATTCAGAGTGACCAGCCTAAGAGCACAAA

TTTAGTTTGGGTGTTCCTCATCACATGTATATATGGACTATCCATCGAACTTAACCTGTGTGGCTTCCAGCCCTCCCTTTACCAAAAGGGTCAATGGACC

TTTCTTTGCACTGTGTGACTTAATCAACTATAAAAGCTTACAATTAGTCTTCACAA
Translation
 - UNI14270 -  - UNI19451 - MRPWEMTSNRQPPSVRPNQHHFSGERCNTPARNRRS - UNI19451 - SPPVRRQRGRRERLSRHNSISQ

DENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQ LHQGTVPVSYTVTTVAPHGLPLCTGQHIPACSTQQVPGCSVVFSGQHLP

VCSVPPP MLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRS PLQRIENEVELLGEHLQVGSFTYPPSAHPPTLPP

SAPLQFLTHDPLHQEVSFGV PYPPFMPRRLTGRSRYRSQQPMPPPPYHPSLLPYVL LSMLPVPPAVGPTFSFELDVEDGEVENYE ALLNLAERLGEA

KPRGLTKADIEQLPSYRFNPSNHQSEQTL LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK - UNI3257 - GNRTCPICRADASEVHRDSE
Transcript ENSMUST00000102934
Sequence
CCCTCGTGCGGCTGGCGGGCGTGCCTCCGGAGGCCGGGGCGGTTGGGACGGCGGGCAGAAAAGATGGGGCTTCCCAGGCGCTAGTCGGCTCCTTCGGCGC

AGGGCGTGGAGCCGTGGGTTTCTGGAGAGGCGCGTGTGATGGTGCCAAGAGGAAGGAAGCGCCGTGACAGCGCCTCAGTCGGAACCCGGGTTCCGAGGGC

AAGGACGATCGGGGACGGCGGCCCTGGCGAGCTGGCCGCCGGCGGGGCGAGCAGTCACAATAGGAGGCGGCGGCCCGGCCGGGAGCGGTGGGAGCAGCCC

CGCAGGGCGGAGCCTCCCCTCGCAG - UNI14270 - ATATCTCCCGGGGCCAATTCAGCACCTCTACCTGGCCATCCTAACAAGGTGATTTGTGAAA

GGGTGAGACTTCAGAGCCTGTTCCCTCTTCTCCCAAGTGATCAGAACACTACCATTCAAGAGGATGCTCACTTCAAAGCTTTCTTCCAG - UNI14270

 - - UNI19451 - AGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCTCCCTCACCA

CCAATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGACCAAATCAACATCACTTCTCAGGGGAACGCTGTAACACACCTGCACGCA

ACAGAAGAAG - UNI19451 - TCCTCCTGTTAGGCGTCAGCGAGGAAGAAGGGAACGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAACTAT

CACCATCTCCCTTATGCACAGCAGCAAGCAATAGAGGAACCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTCTGTTACATCCAGCTGCCCATCCCC

CCCAGCAGAATGCAGTCATGGTTGACATACATGATCAG CTCCATCAAGGAACAGTTCCTGTCTCCTACACGGTAACTACGGTGGCACCCCATGGGCTTC

CACTCTGCACTGGCCAGCACATCCCTGCTTGCAGTACACAGCAGGTCCCAGGATGCTCGGTGGTTTTCAGTGGACAACACCTCCCCGTCTGTAGTGTGCC

TCCTCCA ATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCGTTCCCGCCCCTCATTTCTAGCGATCCGTTTCTTATACATCCTCC

TCATCTTTCTCCCCATCATCCTCCCCACTTGCCACCACCAGGCCAATTTGTCCCTTTCCAAACACAGCAGTCACGATCG CCTCTGCAGAGGATAGAAAA

TGAAGTGGAGCTCTTAGGAGAACATCTTCAAGTAGGCAGTTTTACTTATCCCCCTTCAGCCCATCCCCCAACATTACCTCCGTCAGCTCCTTTGCAGTTC

CTGACACATGACCCTTTGCATCAGGAGGTGTCCTTTGGAGTA CCTTACCCACCATTTATGCCTCGGAGACTCACAGGACGTAGTAGATACCGATCCCAG

CAGCCAATGCCCCCTCCTCCTTACCATCCCAGCTTACTACCATACGTGCT ATCAATGCTTCCAGTACCACCTGCAGTGGGCCCAACCTTCAGCTTTGAA

TTAGATGTAGAAGACGGAGAAGTTGAAAATTATGAG GCCCTGTTAAACTTGGCGGAGAGACTGGGAGAGGCGAAACCTCGGGGACTGACTAAAGCAGAT

ATTGAACAGCTTCCTTCGTACAGGTTCAATCCTAGCAACCACCAGTCAGAGCAGACTTT GTGTGTAGTATGCATGTGTGATTTTGAGTCAAGGCAGCTT

CTTAGAGTCTTACCTTGTAACCACGAGTTCCATGCCAAGTGTGTTGATAAATGGCTTAAG - UNI3257 - GGAAACCGTACCTGCCCAATTTGCCGA

GCTGATGCTTCAGAAGTGCATCGCGATTCAGAGTGACCAGCCTAAGAGCACAAATTTAGTTTGGGTGTTCCTCATCACATGTATATATGGACTATCCATC

GAACTTAACCTGTGTGGCTTCCAGCCCTCCCTTTACCAAAAGGGTCAATGGACCTTTCTTTGCACTGTGTGACTTAATCAACTATAAAAGCTTACAATTA

GTCTTCACAATTATGGGATTGTTATACTAACTGTGTGATTGGAACTCCAAAGACCTTTTCTTTAGCTTAATTTTGTGTGTGCACTAACATTCCCTGGTTT

TTGTGTGATCATTCCGAGTGTTGCTGCAAGATTACAGTGGACGTGATCTTTTAGCATGTGCTTTTATAAAAAGTGGTAGCTCCAGATGATATAGCAATCT

ACCTTATATAGAGCCTTCAGAAACTGTGAGTGGAAGTGAGTGAAGCGTATGACTGCTGGTGATCAGTGAATCTGTGAGAGAATGTGTGCAACTACATGTG

TGGGGGCATGGTAGCTACTGTGTGTGTGAGATCCTATATACCAGCATGTACCAAGAATGTGTGTGTAGTTTTAATTATGCTGCAATGTATAATCTGGTGT

GTTATTTAAACAGCACTAGTACTGTACACTGGTTTTCCCTTGTGTTTGCTGTTGCACACTGATTGCTAAGGGTGCATCCATTCTAAGCATTGAATACTCC

ATCCCCTTCCCGCCCAGTGAATGGAATGAGAAAAGCCTTCTTCCTTTGCTTCAGGCAGCTGTCCCCTTCTCTTCCTTGGTGATCCTGAGTGGGTCACTTA

AGGAAAAAGTATCAGATTCTCACTCCATGACCTGATTTTTTTTGTTGTTGTTTTTTTGTTTTGTAATTTTCAATTCTATTGTAAAAGAAACTTAAGTCTC

CAACTTGCTGTTTCCAAAAAGAAGGTGCAATATCATATACATCATTAGCAATATTAGCATTTCAATCAGCGATCTGAGTGTTAGTTGTTTTTCCTTTACA

TTTCTAGTAGTTTCCTTACAGAAAGGACCTGCATTTTTATTAATGTGTAGATTTATGGTCTGATCTGAAGATGTTTGAGTAATATATTTTTAAGAACACC

ACTGGTCCTGTAAGTCTTGCCTCCTTGGCTTCTACTAGAGCAAAATCTGCTGCCAAGTCAGCCTGGTTTCTGGTTGTGTTCTTCACTCAGGCCTCCATGG

GCAACAATGGTTTCAGGAGAACTGTTTGTTTCTGTGTGAATTGAGTTGACACACTCCAGTCCTGAGCTGCTCTGCTGCCGCTTCCCTCAGTTAACCTTCT

CACCGAAACCTTAGTTCAGGATGGATCAAGTGCTGTGACAGTGACAGCTCATTTCTCAGGCCTGGTTTGCTTTGATGTATTACTCTTCTTCTTTTAATTT

ATGTTAGAACGAGAAAAGCTTAATACAACAGGTGCCCAGAATACTTGCAGTGTAAATGAAGATTGGATTTTTGTATAAAAAGATAATGCTGTCAAACGGG

AACTGACCTTTATTGAATCTGAAATGATACATAGCTGTGTGTGTATATATATTTTTTAAAAATAGGTTCATTGAACATAAATCAGATTGTTTGAGGTCAT

TTTTCAGCAACATTGGATTCCTTTCTCCTCGGTGTGCTCAGCCTTCTCTGCAGCCTCTGTGAGTTTTCAGCACGTGTGCAGCCACACAGGCTGCAACCTT

CCACTCGCAGCCGCTGCTGACACCTGGCTGCCGACCTCACTCAGCTCACAGTGGGCTCCAGGCCCGTTTTTACTCAGACAGGGACAGTGTTCACCTACTT

GATACTGCCGTGTTTCTTACCCTCCCTTGAAGTTTCTCTAAGCTCATCACAGCCTAGAGTTCAGGAAAGTTAATCCACACAGAAGCACAATTTTGTCCTC

TTCCAGACACTGTTGCCTCTACCTAGTTAGACAAATAGGATTTGACCTACATTCTGTTGCCCCTAGGTTTGTGTTAGTGTCAGAAATACTTAAACAGTGG

TAAATGCACATGTTACTTTTAAATCATTAGGATAACTCCTGTCTGGTTCCTAATGAATAAAAGGTGTGTTAAATACCAAGATTATTGACGTATATACTAA

TCAGCTCCAAATCACATACAGTTTAATCTTTATTTTTTTAATTTAAAGAAATCATGTTTAAAATGATAAAACTCCATCTTATATATAGACTTTTGTATAG

CTTCAAGAACTTTATACCTGTACAGCTCTAACATGACACTGCTCCACTCAGTATTCATCCTGTTGACGCACACAGGTGAGCACTTTCCTAACTACTGCAG

ACAGACTGACTGCCAAGGCACACTGTGCTCACGACTGGAAAGTAGCCTTTTTCTTCTATCAATGTTTACCATAAAGTTCCTTTCTCAGTAGATTTTTCTT

TCTTTTTTAAAAGAGGTGGTTGGCAATTTAGGATTCATCTGGGTCTGTCCTGGTAAAGTCCTGCTGTGCAGATGACTGCTGTCTCCTGGGAAGGTCTCGG

CACGGAGCTCTCGAGGCTGTGCAGACCTGCTCGTGGAGGGCTTAGGCTGTCTTAGGTGCACACTTGCACGGTCTCCATGGCCTCCGTGAGCATCTTTGTA

GCTAGCAATGAGGAAGTGCAGGTGTCTACAGGCCATCACGTGGGGAGGCGCACCAGGCGACAGAGGATGTGGTGGCCTTCCTCCTAGGACTGATTGGCGT

CGCCGTCCTAACCCAGCTGTGGAGTTTTTGTATGATTTGATTTGGGGTTTTGCTGTATTTTTGTTTGGTTTGGTTTGGTTTGGTTTGGTATGGTTTGTTT

GGGGTTTTTTTGTTGTTGTTGGTTTTTGTTTTTGTTTTCGTTTTTGCATGAATCGCGATATTTTGTACTTTTAAAAACTCCAACTTCCACAAAACAACTC

AAGGCCTCCAAGTATCAAGATGTCCTGAAATTTTTTTTTTTTTAGCAGAATCTGAAATTAGATTTTGTACACTCCCTGGAATGTAATTGTTAACATTCTT

ACATTTGGGCCTCTTCACACACCGTCTGCCTGCCTGCTTCCTTCTGAGAATATTTTCCCAGTATCTCCAGGCCTTCCTTAGTCTGTCCCACCGTGCATCT

GCTTACCTCATGGCGCTGTTTGTTTCAGATTTTGAAAGCTCACAGGTGTTTGTTGGAATCATTTGCCGAGTCATTTCCTCAAATCATATTCCATTGTGTC

AGTTAACATAGAGTTTTAAATGTATGTATTATAAATACCTGTAACCAAAATCATTTGAAGGCTTGATAAATTTTTAACAAAGTTTGTACATTTTTTATGA

AAGTTACTAGTAATGCTTTACTAAGTAGTGCAATGAATTTTTATTTTTAATCCCTGTGCCCAATTTTGGAGTTTGAGAGGGTTGTTGGTAATAAATGTAT

GATGTACACTTCAAA
Translation
 - UNI14270 -  - UNI14270 - - UNI19451 - MRPWEMTSNRQPPSVRPNQHHFSGERCNTPARNRRS - UNI19451 - SPPVRRQRG

RRERLSRHNSISQDENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQ LHQGTVPVSYTVTTVAPHGLPLCTGQHIPACSTQQV

PGCSVVFSGQHLPVCSVPPP MLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRS PLQRIENEVELLGEHLQVGSF

TYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGV PYPPFMPRRLTGRSRYRSQQPMPPPPYHPSLLPYVL LSMLPVPPAVGPTFSFELDVEDGEVENYE

 ALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTL LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK - UNI3257 - GNRTCPICRA

DASEVHRDSE
Transcript ENSMUST00000045793
Sequence
GGACGTGCGCGGCCCCGCCCCCGCGGGTGGAAACAAAGGGGGCTCGGCGCGGGGGAAGAGGCGGAGCTACCCGGCGATCCTGCGCTTGGCTGGCTAG - 

UNI14270 - ATATCTCCCGGGGCCAATTCAGCACCTCTACCTGGCCATCCTAACAAGGTGATTTGTGAAAGGGTGAGACTTCAGAGCCTGTTCCCTCT

TCTCCCAAGTGATCAGAACACTACCATTCAAGAGGATGCTCACTTCAAAGCTTTCTTCCAG - UNI14270 - - UNI19451 - AGTGAAGATAGT

CCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCTCCCTCACCACCAATGCGACCATGGGAGATGACATCAA

ATAGGCAGCCCCCTTCAGTTCGACCAAATCAACATCACTTCTCAGGGGAACGCTGTAACACACCTGCACGCAACAGAAGAAG - UNI19451 - TCCT

CCTGTTAGGCGTCAGCGAGGAAGAAGGGAACGTCTGTCTCGACATAATTCCATTAGTCAAGATGAAAACTATCACCATCTCCCTTATGCACAGCAGCAAG

CAATAGAGGAACCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTCTGTTACATCCAGCTGCCCATCCCCCCCAGCAGAATGCAGTCATGGTTGACAT

ACATGATCAG CTCCATCAAGGAACAGTTCCTGTCTCCTACACGGTAACTACGGTGGCACCCCATGGGCTTCCACTCTGCACTGGCCAGCACATCCCTGC

TTGCAGTACACAGCAGGTCCCAGGATGCTCGGTGGTTTTCAGTGGACAACACCTCCCCGTCTGTAGTGTGCCTCCTCCA ATGCTTCAGGCATGTTCAGT

TCAGCACTTACCAGTACCATATGCTGCGTTCCCGCCCCTCATTTCTAGCGATCCGTTTCTTATACATCCTCCTCATCTTTCTCCCCATCATCCTCCCCAC

TTGCCACCACCAGGCCAATTTGTCCCTTTCCAAACACAGCAGTCACGATCG CCTCTGCAGAGGATAGAAAATGAAGTGGAGCTCTTAGGAGAACATCTT

CAAGTAGGCAGTTTTACTTATCCCCCTTCAGCCCATCCCCCAACATTACCTCCGTCAGCTCCTTTGCAGTTCCTGACACATGACCCTTTGCATCAGGAGG

TGTCCTTTGGAGTA CCTTACCCACCATTTATGCCTCGGAGACTCACAGGACGTAGTAGATACCGATCCCAGCAGCCAATGCCCCCTCCTCCTTACCATC

CCAGCTTACTACCATACGTGCT ATCAATGCTTCCAGTACCACCTGCAGTGGGCCCAACCTTCAGCTTTGAATTAGATGTAGAAGACGGAGAAGTTGAAA

ATTATGAG GCCCTGTTAAACTTGGCGGAGAGACTGGGAGAGGCGAAACCTCGGGGACTGACTAAAGCAGATATTGAACAGCTTCCTTCGTACAGGTTCA

ATCCTAGCAACCACCAGTCAGAGCAGACTTT GTGTGTAGTATGCATGTGTGATTTTGAGTCAAGGCAGCTTCTTAGAGTCTTACCTTGTAACCACGAGT

TCCATGCCAAGTGTGTTGATAAATGGCTTAAG - UNI3257 - GGAAACCGTACCTGCCCAATTTGCCGAGCTGATGCTTCAGAAGTGCATCGCGATT

CAGAGTGACCAGCCTAAGAGCACAAATTTAGTTTGGGTGTTCCTCATCACATGTATATATGGACTATCCATCGAACTTAACCTGTGTGGCTTCCAGCCCT

CCCTTTACCAAAAGGGTCAATGGACCTTTCTTTGCACTGTGTGACTTAATCAACTATAAAAGCTTACAATTAGTCTTCACAATTATGGGATTGTTATACT

AACTGTGTGATTGGAACTCCAAAGACCTTTTCTTTAGCTTAATTTTGTGTGTGCACTAACATTCCCTGGTTTTTGTGTGATCATTCCGAGTGTTGCTGCA

AGATTACAGTGGACGTGATCTTTTAGCATGTGCTTTTATAAAAAGTGGTAGCTCCAGATGATATAGCAATCTACCTTATATAGAGCCTTCAGAAACTGTG

AGTGGAAGTGAGTGAAGCGTATGACTGCTGGTGATCAGTGAATCTGTGAGAGAATGTGTGCAACTACATGTGTGGGGGCATGGTAGCTACTGTGTGTGTG

AGATCCTATATACCAGCATGTACCAAGAATGTGTGTGTAGTTTTAATTATGCTGCAATGTATAATCTGGTGTGTTATTTAAACAGCACTAGTACTGTACA

CTGGTTTTCCCTTGTGTTTGCTGTTGCACACTGATTGCTAAGGGTGCATCCATTCTAAGCATTGAATACTCCATCCCCTTCCCGCCCAGTGAATGGAATG

AGAAAAGCCTTCTTCCTTTGCTTCAGGCAGCTGTCCCCTTCTCTTCCTTGGTGATCCTGAGTGGGTCACTTAAGGAAAAAGTATCAGATTCTCACTCCAT

GACCTGATTTTTTTTGTTGTTGTTTTTTTGTTTTGTAATTTTCAATTCTATTGTAAAAGAAACTTAAGTCTCCAACTTGCTGTTTCCAAAAAGAAGGTGC

AATATCATATACATCATTAGCAATATTAGCATTTCAATCAGCGATCTGAGTGTTAGTTGTTTTTCCTTTACATTTCTAGTAGTTTCCTTACAGAAAGGAC

CTGCATTTTTATTAATGTGTAGATTTATGGTCTGATCTGAAGATGTTTGAGTAATATATTTTTAAGAACACCACTGGTCCTGTAAGTCTTGCCTCCTTGG

CTTCTACTAGAGCAAAATCTGCTGCCAAGTCAGCCTGGTTTCTGGTTGTGTTCTTCACTCAGGCCTCCATGGGCAACAATGGTTTCAGGAGAACTGTTTG

TTTCTGTGTGAATTGAGTTGACACACTCCAGTCCTGAGCTGCTCTGCTGCCGCTTCCCTCAGTTAACCTTCTCACCGAAACCTTAGTTCAGGATGGATCA

AGTGCTGTGACAGTGACAGCTCATTTCTCAGGCCTGGTTTGCTTTGATGTATTACTCTTCTTCTTTTAATTTATGTTAGAACGAGAAAAGCTTAATACAA

CAGGTGCCCAGAATACTTGCAGTGTAAATGAAGATTGGATTTTTGTATAAAAAGATAATGCTGTCAAACGGGAACTGACCTTTATTGAATCTGAAATGAT

ACATAGCTGTGTGTGTATATATATTTTTTAAAAATAGGTTCATTGAACATAAATCAGATTGTTTGAGGTCATTTTTCAGCAACATTGGATTCCTTTCTCC

TCGGTGTGCTCAGCCTTCTCTGCAGCCTCTGTGAGTTTTCAGCACGTGTGCAGCCACACAGGCTGCAACCTTCCACTCGCAGCCGCTGCTGACACCTGGC

TGCCGACCTCACTCAGCTCACAGTGGGCTCCAGGCCCGTTTTTACTCAGACAGGGACAGTGTTCACCTACTTGATACTGCCGTGTTTCTTACCCTCCCTT

GAAGTTTCTCTAAGCTCATCACAGCCTAGAGTTCAGGAAAGTTAATCCACACAGAAGCACAATTTTGTCCTCTTCCAGACACTGTTGCCTCTACCTAGTT

AGACAAATAGGATTTGACCTACATTCTGTTGCCCCTAGGTTTGTGTTAGTGTCAGAAATACTTAAACAGTGGTAAATGCACATGTTACTTTTAAATCATT

AGGATAACTCCTGTCTGGTTCCTAATGAATAAAAGGTGTGTTAAATACCAAGATTATTGACGTATATACTAATCAGCTCCAAATCACATACAGTTTAATC

TTTATTTTTTTAATTTAAAGAAATCATGTTTAAAATGATAAAACTCCATCTTATATATAGACTTTTGTATAGCTTCAAGAACTTTATACCTGTACAGCTC

TAACATGACACTGCTCCACTCAGTATTCATCCTGTTGACGCACACAGGTGAGCACTTTCCTAACTACTGCAGACAGACTGACTGCCAAGGCACACTGTGC

TCACGACTGGAAAGTAGCCTTTTTCTTCTATCAATGTTTACCATAAAGTTCCTTTCTCAGTAGATTTTTCTTTCTTTTTTAAAAGAGGTGGTTGGCAATT

TAGGATTCATCTGGGTCTGTCCTGGTAAAGTCCTGCTGTGCAGATGACTGCTGTCTCCTGGGAAGGTCTCGGCACGGAGCTCTCGAGGCTGTGCAGACCT

GCTCGTGGAGGGCTTAGGCTGTCTTAGGTGCACACTTGCACGGTCTCCATGGCCTCCGTGAGCATCTTTGTAGCTAGCAATGAGGAAGTGCAGGTGTCTA

CAGGCCATCACGTGGGGAGGCGCACCAGGCGACAGAGGATGTGGTGGCCTTCCTCCTAGGACTGATTGGCGTCGCCGTCCTAACCCAGCTGTGGAGTTTT

TGTATGATTTGATTTGGGGTTTTGCTGTATTTTTGTTTGGTTTGGTTTGGTTTGGTTTGGTATGGTTTGTTTGGGGTTTTTTTGTTGTTGTTGGTTTTTG

TTTTTGTTTTCGTTTTTGCATGAATCGCGATATTTTGTACTTTTAAAAACTCCAACTTCCACAAAACAACTCAAGGCCTCCAAGTATCAAGATGTCCTGA

AATTTTTTTTTTTTTAGCAGAATCTGAAATTAGATTTTGTACACTCCCTGGAATGTAATTGTTAACATTCTTACATTTGGGCCTCTTCACACACCGTCTG

CCTGCCTGCTTCCTTCTGAGAATATTTTCCCAGTATCTCCAGGCCTTCCTTAGTCTGTCCCACCGTGCATCTGCTTACCTCATGGCGCTGTTTGTTTCAG

ATTTTGAAAGCTCACAGGTGTTTGTTGGAATCATTTGCCGAGTCATTTCCTCAAATCATATTCCATTGTGTCAGTTAACATAGAGTTTTAAATGTATGTA

TTATAAATACCTGTAACCAAAATCATTTGAAGGCTTGATAAATTTTTAACAAAGTTTGTACATTTTTTATGAAAGTTACTAGTAATGCTTTACTAAGTAG

TGCAATGAATTTTTATTTTTAATCCCTGTGCCCAATTTTGGAGTTTGAGAGGGTTGTTGGTAATAAATGTATGATGTACACTTCAAACC
Translation
 - UNI14270 -  - UNI14270 - - UNI19451 - MRPWEMTSNRQPPSVRPNQHHFSGERCNTPARNRRS - UNI19451 - SPPVRRQRG

RRERLSRHNSISQDENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQ LHQGTVPVSYTVTTVAPHGLPLCTGQHIPACSTQQV

PGCSVVFSGQHLPVCSVPPP MLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRS PLQRIENEVELLGEHLQVGSF

TYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGV PYPPFMPRRLTGRSRYRSQQPMPPPPYHPSLLPYVL LSMLPVPPAVGPTFSFELDVEDGEVENYE

 ALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTL LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK - UNI3257 - GNRTCPICRA

DASEVHRDSE
Transcript ENSMUST00000098098
Sequence
GTTCCCGCGGCGGCGGGGAGCCGGCCCGCCCCTGCCTGGACGAGACGCAGGTGAAGTGATGATGTCACTTGGGAGAACTCAGAACCCGGTTGGAGGGGTC

CTCTCTCGCGGCCTTCTACCTCCGCGGGTTTCTGGACGGGCTCCGTTTTGTTCTCAGTGGATGGAAGTTCTTCCTTTCAGGGCTGAAGAATGAGAGAG -

 UNI14270 - - UNI19451 - AGTGAAGATAGTCCAAGTCCTAAGAGACAGCGCCTCTCTCATTCAGTCTTTGATTATACATCAGCATCACCAGCT

CCCTCACCACCAATGCGACCATGGGAGATGACATCAAATAGGCAGCCCCCTTCAGTTCGACCAAATCAACATCACTTCTCAGGGGAACGCTGTAACACAC

CTGCACGCAACAGAAGAAG - UNI19451 - TCCTCCTGTTAGGCGTCAGCGAGGAAGAAGGGAACGTCTGTCTCGACATAATTCCATTAGTCAAGAT

GAAAACTATCACCATCTCCCTTATGCACAGCAGCAAGCAATAGAGGAACCTCGAGCCTTCCACCCTCCGAATGTATCTCCCCGTCTGTTACATCCAGCTG

CCCATCCCCCCCAGCAGAATGCAGTCATGGTTGACATACATGATCAG CTCCATCAAGGAACAGTTCCTGTCTCCTACACGGTAACTACGGTGGCACCCC

ATGGGCTTCCACTCTGCACTGGCCAGCACATCCCTGCTTGCAGTACACAGCAGGTCCCAGGATGCTCGGTGGTTTTCAGTGGACAACACCTCCCCGTCTG

TAGTGTGCCTCCTCCA ATGCTTCAGGCATGTTCAGTTCAGCACTTACCAGTACCATATGCTGCGTTCCCGCCCCTCATTTCTAGCGATCCGTTTCTTAT

ACATCCTCCTCATCTTTCTCCCCATCATCCTCCCCACTTGCCACCACCAGGCCAATTTGTCCCTTTCCAAACACAGCAGTCACGATCG CCTCTGCAGAG

GATAGAAAATGAAGTGGAGCTCTTAGGAGAACATCTTCAAGTAGGCAGTTTTACTTATCCCCCTTCAGCCCATCCCCCAACATTACCTCCGTCAGCTCCT

TTGCAGTTCCTGACACATGACCCTTTGCATCAGGAGGTGTCCTTTGGAGTA CCTTACCCACCATTTATGCCTCGGAGACTCACAGGACGTAGTAGATAC

CGATCCCAGCAGCCAATGCCCCCTCCTCCTTACCATCCCAGCTTACTACCATACGTGCT ATCAATGCTTCCAGTACCACCTGCAGTGGGCCCAACCTTC

AGCTTTGAATTAGATGTAGAAGACGGAGAAGTTGAAAATTATGAG GCCCTGTTAAACTTGGCGGAGAGACTGGGAGAGGCGAAACCTCGGGGACTGACT

AAAGCAGATATTGAACAGCTTCCTTCGTACAGGTTCAATCCTAGCAACCACCAGTCAGAGCAGACTTT GTGTGTAGTATGCATGTGTGATTTTGAGTCA

AGGCAGCTTCTTAGAGTCTTACCTTGTAACCACGAGTTCCATGCCAAGTGTGTTGATAAATGGCTTAAG - UNI3257 - GGAAACCGTACCTGCCCA

ATTTGCCGAGCTGATGCTTCAGAAGTGCATCGCGATTCAGAGTGACCAGCCTAAGAGCACAAATTTAGTTTGGGTGTTCCTCATCACATGTATATATGGA

CTATCCATCGAACTTAACCTGTGTGGCTTCCAGCCCTCCCTTTACCAAAAGGGTCAATGGACCTTTCTTTGCACTGTGTGACTTAATCAACTATAAAAGC

TTACAATTAGTCTTCACAATTATGGGATTGTTATACTAACTGTGTGATTGGAACTCCAAAGACCTTTTCTTTAGCTTAATTTTGTGTGTGCACTAACATT

CCCTGGTTTTTGTGTGATCATTCCGAGTGTTGCTGCAAGATTACAGTGGACGTGATCTTTTAGCATGTGCTTTTATAAAAAGTGGTAGCTCCAGATGATA

TAGCAATCTACCTTATATAGAGCCTTCAGAAACTGTGAGTGGAAGTGAGTGAAGCGTATGACTGCTGGTGATCAGTGAATCTGTGAGAGAATGTGTGCAA

CTACATGTGTGGGGGCATGGTAGCTACTGTGTGTGTGAGATCCTATATACCAGCATGTACCAAGAATGTGTGTGTAGTTTTAATTATGCTGCAATGTATA

ATCTGGTGTGTTATTTAAACAGCACTAGTACTGTACACTGGTTTTCCCTTGTGTTTGCTGTTGCACACTGATTGCTAAGGGTGCATCCATTCTAAGCATT

GAATACTCCATCCCCTTCCCGCCCAGTGAATGGAATGAGAAAAGCCTTCTTCCTTTGCTTCAGGCAGCTGTCCCCTTCTCTTCCTTGGTGATCCTGAGTG

GGTCACTTAAGGAAAAAGTATCAGATTCTCACTCCATGACCTGATTTTTTTTGTTGTTGTTTTTTTGTTTTGTAATTTTCAATTCTATTGTAAAAGAAAC

TTAAGTCTCCAACTTGCTGTTTCCAAAAAGAAGGTGCAATATCATATACATCATTAGCAATATTAGCATTTCAATCAGCGATCTGAGTGTTAGTTGTTTT

TCCTTTACATTTCTAGTAGTTTCCTTACAGAAAGGACCTGCATTTTTATTAATGTGTAGATTTATGGTCTGATCTGAAGATGTTTGAGTAATATATTTTT

AAGAACACCACTGGTCCTGTAAGTCTTGCCTCCTTGGCTTCTACTAGAGCAAAATCTGCTGCCAAGTCAGCCTGGTTTCTGGTTGTGTTCTTCACTCAGG

CCTCCATGGGCAACAATGGTTTCAGGAGAACTGTTTGTTTCTGTGTGAATTGAGTTGACACACTCCAGTCCTGAGCTGCTCTGCTGCCGCTTCCCTCAGT

TAACCTTCTCACCGAAACCTTAGTTCAGGATGGATCAAGTGCTGTGACAGTGACAGCTCATTTCTCAGGCCTGGTTTGCTTTGATGTATTACTCTTCTTC

TTTTAATTTATGTTAGAACGAGAAAAGCTTAATACAACAGGTGCCCAGAATACTTGCAGTGTAAATGAAGATTGGATTTTTGTATAAAAAGATAATGCTG

TCAAACGGGAACTGACCTTTATTGAATCTGAAATGATACATAGCTGTGTGTGTATATATATTTTTTAAAAATAGGTTCATTGAACATAAATCAGATTGTT

TGAGGTCATTTTTCAGCAACATTGGATTCCTTTCTCCTCGGTGTGCTCAGCCTTCTCTGCAGCCTCTGTGAGTTTTCAGCACGTGTGCAGCCACACAGGC

TGCAACCTTCCACTCGCAGCCGCTGCTGACACCTGGCTGCCGACCTCACTCAGCTCACAGTGGGCTCCAGGCCCGTTTTTACTCAGACAGGGACAGTGTT

CACCTACTTGATACTGCCGTGTTTCTTACCCTCCCTTGAAGTTTCTCTAAGCTCATCACAGCCTAGAGTTCAGGAAAGTTAATCCACACAGAAGCACAAT

TTTGTCCTCTTCCAGACACTGTTGCCTCTACCTAGTTAGACAAATAGGATTTGACCTACATTCTGTTGCCCCTAGGTTTGTGTTAGTGTCAGAAATACTT

AAACAGTGGTAAATGCACATGTTACTTTTAAATCATTAGGATAACTCCTGTCTGGTTCCTAATGAATAAAAGGTGTGTTAAATACCAAGATTATTGACGT

ATATACTAATCAGCTCCAAATCACATACAGTTTAATCTTTATTTTTTTAATTTAAAGAAATCATGTTTAAAATGATAAAACTCCATCTTATATATAGACT

TTTGTATAGCTTCAAGAACTTTATACCTGTACAGCTCTAACATGACACTGCTCCACTCAGTATTCATCCTGTTGACGCACACAGGTGAGCACTTTCCTAA

CTACTGCAGACAGACTGACTGCCAAGGCACACTGTGCTCACGACTGGAAAGTAGCCTTTTTCTTCTATCAATGTTTACCATAAAGTTCCTTTCTCAGTAG

ATTTTTCTTTCTTTTTTAAAAGAGGTGGTTGGCAATTTAGGATTCATCTGGGTCTGTCCTGGTAAAGTCCTGCTGTGCAGATGACTGCTGTCTCCTGGGA

AGGTCTCGGCACGGAGCTCTCGAGGCTGTGCAGACCTGCTCGTGGAGGGCTTAGGCTGTCTTAGGTGCACACTTGCACGGTCTCCATGGCCTCCGTGAGC

ATCTTTGTAGCTAGCAATGAGGAAGTGCAGGTGTCTACAGGCCATCACGTGGGGAGGCGCACCAGGCGACAGAGGATGTGGTGGCCTTCCTCCTAGGACT

GATTGGCGTCGCCGTCCTAACCCAGCTGTGGAGTTTTTGTATGATTTGATTTGGGGTTTTGCTGTATTTTTGTTTGGTTTGGTTTGGTTTGGTTTGGTAT

GGTTTGTTTGGGGTTTTTTTGTTGTTGTTGGTTTTTGTTTTTGTTTTCGTTTTTGCATGAATCGCGATATTTTGTACTTTTAAAAACTCCAACTTCCACA

AAACAACTCAAGGCCTCCAAGTATCAAGATGTCCTGAAATTTTTTTTTTTTTAGCAGAATCTGAAATTAGATTTTGTACACTCCCTGGAATGTAATTGTT

AACATTCTTACATTTGGGCCTCTTCACACACCGTCTGCCTGCCTGCTTCCTTCTGAGAATATTTTCCCAGTATCTCCAGGCCTTCCTTAGTCTGTCCCAC

CGTGCATCTGCTTACCTCATGGCGCTGTTTGTTTCAGATTTTGAAAGCTCACAGGTGTTTGTTGGAATCATTTGCCGAGTCATTTCCTCAAATCATATTC

CATTGTGTCAGTTAACATAGAGTTTTAAATGTATGTATTATAAATACCTGTAACCAAAATCATTTGAAGGCTTGATAAATTTTTAACAAAGTTTGTACAT

TTTTTATGAAAGTTACTAGTAATGCTTTACTAAGTAGTGCAATGAATTTTTATTTTTAATCCCTGTGCCCAATTTTGGAGTTTGAGAGGGTTGTTGGTAA

TAAATGTATGATGTACACTTCAAA
Translation
MRE - UNI14270 - - UNI19451 - SEDSPSPKRQRLSHSVFDYTSASPAPSPPMRPWEMTSNRQPPSVRPNQHHFSGERCNTPARNRRS - UN

I19451 - SPPVRRQRGRRERLSRHNSISQDENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQ LHQGTVPVSYTVTTVAPH

GLPLCTGQHIPACSTQQVPGCSVVFSGQHLPVCSVPPP MLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRS PLQ

RIENEVELLGEHLQVGSFTYPPSAHPPTLPPSAPLQFLTHDPLHQEVSFGV PYPPFMPRRLTGRSRYRSQQPMPPPPYHPSLLPYVL LSMLPVPPAVG

PTFSFELDVEDGEVENYE ALLNLAERLGEAKPRGLTKADIEQLPSYRFNPSNHQSEQTL LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK - UN

I3257 - GNRTCPICRADASEVHRDSE

For any suggestions or comments, please send an email to unitrap@crg.es