Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035722 (Abca7)
Chromosomal location
Chr 10: 79460360 - 79478313 (+)
Description
ATP-binding cassette, sub-family A (ABC1), member 7 Gene [Source:MGI Symbol;Acc:MGI:1351646]
RefSeq_dna
NM_013850 
RefSeq_peptide
NP_038878.1 
MGI
MGI:1351646 
Uniprot/SWISSPROT
Q91V24 
Uniprot/SPTREMBL
B2RWU5 Q8R1I3 
Human Ortholog
ENSG00000064687 (ABCA7)
Omim not available
UniTrap UNI36360
Vector Insertion
Chr 10: 79467839 - 79468387
Public Clones IST12872D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37140
Vector Insertion
Chr 10: 79477933 - 79478050
Public Clones CMHD-GT_112H6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043866
Sequence
ATGGCCTTAGGCACACAGCTGATGCTTCTGCTGTGGAAAAATTACACCTATCGACGGAGACAACCG ATCCAACTACTAGTGGAGTTGCTTTGGCCCCTC

TTCCTCTTCTTCATCCTAGTGGCTGTCCGTCACTCCCACCCCCCTCTGGAGCATCACGAAT GCCACTTTCCAAACAAGCCATTACCATCGGCGGGCACG

GTGCCCTGGCTGCAGGGCCTTGTCTGCAACGTAAACAACTCCTGCTTCCAGCACCCAACGCCTGGCGAGAAGCCTGGGGTCCTGAGTAACTTTAAGGATT

CCTT GATCTCGAGGCTCCTCGCTGATACCCGCACAGTGCTCGGGGGCCACAGCATCCAGGACATGCTGGATGCCCTGGGGAAACTGATCCCCGTGCTCA

GGGCAGTTGGAGGTGGAG CACGACCACAGGAGAGTGACCAGCCGACCAGTCAAGGGTCAGTGACTAAGCTTCTGGAGAAGATCCTGCAAAGG GCATCC

CTGGATCCTGTGCTGGGTCAAGCCCAGGATTCTATGAGAAAGTTCTCAGATGCTATCAGGGATCTTGCCCAGGAG CTCCTGACACTGCCCAGCCTGATG

GAGCTCCGAGCTTTGCTGCGGAGGCCCCGAGGGTCAGCTGGTTCTCTGGAGCTGGTTTCGGAGGCCCTCTGCAGTACCAAGGGACCCAGCAGTCCAGGGG

GCCTGTCCCTCAATTGGTACGAAGCCAACCAGCTTAATGAGTTCATGGGGCCAGAGGTGGCCCCTGCCCTGCCTGACAACAGTCTCA GCCCTGCCTGCT

CTGAGTTTGTGGGGACACTGGATGACCACCCTGTGTCTCGGCTGCTCTGGAGGCGCCTGAAGCCATTGATCCTCGGGAAAATTCTCTTTGCACCTGACAC

AAACTTCACTCGGAAGCTCATGGCTCAG GTGAACCAGACCTTCGAGGAGCTGGCTCTGTTGAGGGACCTACACGAACTCTGGGGGGTGCTGGGACCCCA

GATCTTCAACTTCATGAATGACAGTACCAACGTGGCCATGCTTCAG AGGCTTCTGGATGTGGGGGGCACAGGGCAGAGGCAGCAGACACCCAGAGCCCA

GAAGAAGTTGGAGGCTATCAAAGACTTTCTGGATCCTAGTAGGGGTGGCTACAGCTGGCGGGAGGCCCACGCAGATATGGGACGCCTGGCTGGAATCCTA

GGACAAATGATGGAG TGTGTGTCCCTGGACAAGCTGGAGGCTGTGCCCTCAGAGGAAGCTCTTGTGTCCCGTGCCCTGGAGCTGCTGGGTGAGCGCCGC

CTCTGGGCAGGCATCGTGTTCCTGAGCCCAGAGCATCCTCTGGACCCATCCGAACTGTCATCTCCAGCCCTGAGTCCTGGCCACCTACGATTCAAGATTC

GAATGGATATCGATGATGTCACAAGGACCAATAAGATCAGGGACAA GTTTTGGGACCCAGGTCCGTCAGCAGATCCTTTCATGGACCTTCGGTATGTGT

GGGGAGGCTTCGTGTACCTGCAGGACCTGCTGGAGCAGGCAGCTGTGCGAGTGCTCGGTGGCGGGAACTCCCGCACAGGTCTCTACCTGCAGCAGATGCC

ACACCCCTGCTACGTGGATGATGT GTTCCTGCGGGTGCTGAGCCGGTCTCTGCCTCTGTTTCTGACTCTGGCCTGGATTTATTCGGTGGCGCTCACTGT

GAAGGCCGTGGTGCGTGAGAAAGAGACACGGCTGCGAGAAACCATGCGTGCGATGGGGCTGAGCCGCGCGGTGCTCTGGCTTGGTTGGTTCCTCAGCTGC

CTGGGACCCTTCCTGGTCAGCGCTGCGTTGCTGGTATTAGTGCTTAAG CTAGGGAACATCCTTCCTTACAGCCACCCGGTTGTAATCTTCCTTTTCTTG

GCGGCCTTCGCGGTGGCCACCGTCGCTCAGAGTTTTCTGCTCAGCGCCTTCTTCTCCAGGGCCAACCTGGCAGCAGCCTGCGGGGGGCTCGCCTATTTTG

CGCTCTATCTGCCCTACGTACTGTGTGTGGCCTGGCGCGAGCGCCTGCACCTGGGCGGACTCTTAGCTGCG AGCCTGCTGTCCCCTGTAGCCTTTGGCT

TTGGATGCGAAAGCCTGGCGCTACTAGAGGAGCAGGGAGACGGGGCTCAGTGGCACAATTTGGGCACAGGCCCCGCGGAGGACGTCTTCAGCCTGGCCCA

GGTGTCTGCCTTCCTGTTGCTTGATGCCGTCATCTACGGCCTTGCCCTCTGGTACCTAGAGGCTGTGTGCCCAG GCCAGTATGGAATCCCTGAACCATG

GAATTTCCCTTTTCGGAGGAGCTACTGGTGTGGACCTGGGCCTCCCAAGAGTTCTGTCTTGGCCCCTGCCCCACAAGATCCCAAGG TTCTGGTGGAAGA

GCCACCCCTTGGCCTGGTTCCTGGTGTCTCCATTCGAGGCCTGAAGAAACATTTTCGTGGCTGTCCGCAGCCAGCCCTGCAAGGACTCAACCTTGACTTC

TACGAAGGCCACATCACTGCCTTTTTGGGTCACAACGGGGCTGGCAAGACAACCACACT GTCCATTTTGAGTGGTCTCTTCCCACCCAGTAGTGGCTCG

GCCTCCATCCTGGGCCATGATGTACAAACCAACATGGCAGCCATCCGGCCCCACCTGGGCATCTGCCCGCAGTACAATGTGCTGTTTGATAT GCTGACA

GTGGAAGAACATGTTTGGTTCTATGGCCGTTTGAAAGGCGTGAGTGCAGCCGCCATGGGCCCCGAGCGGGAACGTCTGATACGGGATGTGGGGCTTACCC

TCAAGCGGGACACACAGACACGCCACCTCTCTG - UNI36360 - GTGGAATGCAGAGAAAACTTTCTGTGGCCATTGCCTTTGTGGGTGGCTCTCGT

GTGGTCATCATGGACGAGCCCACTGCTGGTGTGGACCCCGCTTCCCGCCGTGGCATTTGGGAATTGCTACTTAAGTACAGAGAAG GTCGGACACTGATT

CTCTCCACTCACCACCTGGATGAGGCAGAGCTCTTGGGAGATCGCGTGGCCATGGTGGCAGGTGGCTCTTTGTGCTGCTGTGGGTCCCCGCTTTTCTTGC

GCCGACACTTGGGCTGCGGTTACTACCTGACCCTGGTGAAGAGTTCTCAGTCCCTCGTCACCCATGATGCTAAG GGAGACAGTGAGGACCCCAGACGGG

AAAAGAAGTCAGATGGCAATGGCAGGACGTCAG ACACAGCGTTCACACGAGGAACCTCAGACAAGAGCAACCAGGCCCCGGCTCCTGGCGCCGTTCCCA

TCACCCCAAGCACAGCCCGGATACTAGAGCTAGTGCAGCAGCATGTGCCTGGAGCACAACTCGTGGAGGACCTGCCCCATGAGCTTCTGCTTGTGCTACC

CTATGCGGGGGCCCTGGATGGCAGCTTCGCCATGGTCTTCCAGGAGCTGGATCAGCAGCTGGAGCTCCTGGGTCTCACAGGCTACGGGATCTCGGACACC

AACCTGGAGGAG ATCTTCCTAAAGGTGGTGGAGGATGCGCACAGAGAAG GTGGGGACTCTAGACCGCAGCTGCACCTTCGCACATGCACTCCACAGCC

CCCCACAGGGCCAGAGGCATCAGTTCTGGAGAATGGGGAGCTGG CCCCACAGGGCTTGGCACCCAACGCTGCCCAAGTGCAAGGCTGGACACTTACCTG

TCAACAGCTCCGGGCTCTGCTCCACAAGCGTTTTCTGCTTGCTCGCCGCAGCCGCCGGGGCCTGTTTGCACAG GTTGTGTTGCCTGCCCTCTTTGTGGG

CCTGGCCCTGTTCTTCAGCCTCATTGTGCCTCCTTTTGGCCAGTACCCACCCCTGCAGCTCAGCCCTGCTATGTATGGCCCTCAGGTCTCGTTCTTCAG 

TGAGGATGCCCCTGGGGACCCCAACCGGATGAAGCTGCTGGAGGCTCTGCTAGGGGAGGCTGGGCTGCAGGAACCCAGTATGCAGGACAAAGATGCCAG 

GGGATCTGAGTGTACACACTCCCTAGCTTGCTACTTCACGGTCCCTGAGGTCCCTCCTGATGTGGCCAGCATCCTGGCCAGTGGCAACTGGACGCCAGAA

TCTCCATCCCCAGCTTGCCAATGCAGTCAGCCTGGAGCCCGCCGCCTGTTGCCAGATTGCCCGGCTGGAGCTGGGGGTCCACCACCCCCCCAGGCTGTGG

CTGGCTTGGGGGAGGTGGTCCAGAACCTCACTGGCCGAAATGTGTCTGACTTTTTGGTGAAGACATACCCCAGCCTGGTGCGCCGAGG CCTAAAGACCA

AGAAGTGGGTGGATGAGGTCAG ATATGGGGGCTTCTCCCTGGGAGGCCGAGATCCAGACCTGCCCACAGGGCATGAGGTGGTCCGCACATTGGCAGAGA

TTCGGGCACTGCTGAGCCCCCAACCTGGGAATGCGCTAGACCGTATCCTGAACAACCTCACTCAGTGGGCCCTTGGCCTTGATGCTCGGAACAGCCTCAA

G ATCTGGTTCAACAACAAGGGCTGGCATGCCATGGTGGCCTTTGTGAACCGAGCCAACAATGGACTCCTACATGCCCTCCTACCATCTGGTCCAGTCCG

CCATGCCCACAGCATCACTACACTCAACCATCCTTTGAACTTGACCAAGGAGCAGCTATCTGAAGCTACACT GATAGCCTCCTCTGTGGATGTCCTTGT

CTCCATCTGTGTGGTCTTCGCCATGTCATTTGTCCCAGCCAGCTTTACCCTGGTCCTCATAGAGGAACGCATCACCAGAGCCAAGCATCTGCAGCTGGTC

AGCGGCCTGCCCCAAACCCTCTATTGGCTTGGCAACTTCCTCTGGGACATG TGTAACTACTTGGTGGCAGTGTGCATAGTGGTGTTCATCTTCCTAGCC

TTTCAGCAGAGAGCCTATGTGGCCCCAGAGAACCTGCCTGCTCTCTTACTCTTGCTTCTGCTGTATGG GTGGTCTATCACACCACTCATGTACCCAGCC

TCCTTCTTCTTCTCAGTGCCCAGCACGGCCTATGTGGTGCTCACCTGCATCAACCTCTTCATTGGCATCAATAGCAGCATGGCCACCTTCGTGCTAGAAC

TGCTTTCAGATCAG AACCTGCAAGAAGTGAGCCGGATCCTGAAACAAGTGTTTCTTATTTTCCCCCACTTTTGCCTTGGCCGAGGGCTCATTGACATGG

TTCGGAACCAGGCCATGGCAGATGCCTTTGAGCGCTTAG GAGACAAGCAATTTCAGTCACCCCTACGCTGGGACATCATTGGCAAGAACCTCCTGGCCA

TGATGGCCCAGGGACCTCTGTTCCTCCTCATCACACTCCTGCTCCAACACCGCAACCGTCTCCTGCCACA ATCAAAACCAAGACTGCTGCCGCCCCTGG

GGGAGGAGGATGAGGATGTGGCTCAAGAGCGTGAGCGGGTGACCAAGGGGGCTACCCAGGGGGATGTGCTAGTCCTCAGGGACTTGACCAAG GTTTACC

GTGGGCAGAGGAACCCAGCTGTGGATCGCCTGTGCTTAGGGATCCCCCCTGGGGAG TGTTTCGGGCTGCTGGGTGTCAACGGGGCAGGGAAGACATCCA

CCTTCCGCATGGTGACAGGGGACACACTGCCCAGCAGTGGTGAAGCAGTACTGGCAGGCCACAA CGTGGCCCAGGAGCGGTCTGCCGCACACCGCAGCA

TGGGCTACTGTCCCCAGTCTGATGCCATCTTCGACCTGCTGACCGGCCGGGAACATCTGGAACTGTTTGCTCGCCTGCGCGGGGTGCCCGAGGCCCAAGT

TGCCCAG ACTGCGCTCTCTGGCCTGGTGCGCCTGGGCCTTCCTAGCTATGCAGACCGACCCGCGGGTACCTACAGCGGAGGCAACAAACGGAAGCTGGC

GACAGCCTTAGCTCTGGTTGGTGACCCAGCTGTGGTCTTTCTG GACGAGCCCACCACAGGCATGGACCCAAGTGCGCGGCGATTTCTTTGGAACAGCTT

GCTGTCCGTGGTGCGCGAGGGCCGCTCCGTAGTGCTCACGTCGCACAG CATGGAGGAGTGCGAAGCGCTCTGCACGCGCCTGGCCATCATGGTGAACGG

GCGGTTCCGCTGTCTGGGAAGCTCTCAGCATCTCAAAGGCAG GTTCGGGGCTGGCCACACACTGACTCTAAGGGTCCCACCGGACCAGCCTGAGCCGGC

GATAGCCTTCATCAGGATCACATTCCCTGGGGCTGAACTCCGGGAGGTGCACGGCAGCCGTCTGCGCTTCCAACTGCCACCGGGGGGCAGATGCACCCTG

ACACGAGTGTTCAGGGAGCTGGCTGCCCAGGGCAGGGCCCACGGTGTGGAGGACTTCTCTGTGAGCCAGACCACTCTGGAGGAG - UNI37140 - GT

GTTCCTATATTTCTCCAAAGACCAAGGGGAAGAGGAAGAGAGCAGTCGGCAGGAGGCTGAAGAAGAGGAGGTTTCCAAACCTGGCCGGCAGCATCCCAAA

CGTGTCAGCCGATTCCTGGAAGACCCCAGCTCTGTGGAGACCATGATCTGAGCATGCCTGCCTTGGGACTGAGTGGCAAAGCTCAGACAGAGGATCTCTG

TACCATACGCTGGCTCCCAGAAAGCCTTGGGCTCTGGGGGAAATAAAAAGAAACTAGAATG
Translation
MALGTQLMLLLWKNYTYRRRQP IQLLVELLWPLFLFFILVAVRHSHPPLEHHEC CHFPNKPLPSAGTVPWLQGLVCNVNNSCFQHPTPGEKPGVLSNF

KDSL LISRLLADTRTVLGGHSIQDMLDALGKLIPVLRAVGGGA ARPQESDQPTSQGSVTKLLEKILQR ASLDPVLGQAQDSMRKFSDAIRDLAQE L

LTLPSLMELRALLRRPRGSAGSLELVSEALCSTKGPSSPGGLSLNWYEANQLNEFMGPEVAPALPDNSLS SPACSEFVGTLDDHPVSRLLWRRLKPLIL

GKILFAPDTNFTRKLMAQ VNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQ RLLDVGGTGQRQQTPRAQKKLEAIKDFLDPSRGGYSWREAH

ADMGRLAGILGQMME CVSLDKLEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDIDDVTRTNKIRDK KFWDPG

PSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNSRTGLYLQQMPHPCYVDDV VFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMG

LSRAVLWLGWFLSCLGPFLVSAALLVLVLK LGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLG

GLLAA SLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDVFSLAQVSAFLLLDAVIYGLALWYLEAVCPG GQYGIPEPWNFPFRRSYWCGPGPPK

SSVLAPAPQDPKV VLVEEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTL LSILSGLFPPSSGSASILGHDVQTNMA

AIRPHLGICPQYNVLFDM MLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSG - UNI36360 - GGMQRKLSVAIAFVGGSRV

VIMDEPTAGVDPASRRGIWELLLKYREG GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAK GDSEDPR

REKKSDGNGRTSD DTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGI

SDTNLEE IFLKVVEDAHREG GGDSRPQLHLRTCTPQPPTGPEASVLENGELA APQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQ V

VLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGPQVSFFS SEDAPGDPNRMKLLEALLGEAGLQEPSMQDKDAR RGSECTHSLACYFTVPEVPPDVA

SILASGNWTPESPSPACQCSQPGARRLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRG GLKTKKWVDEVR RYGGFSLGGRDP

DLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDARNSLK IWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQ

LSEATL LIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDM CNYLVAVCIVVFIFLAFQQRAYVAPENLPALL

LLLLLYG GWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELLSDQ NLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLG

 GDKQFQSPLRWDIIGKNLLAMMAQGPLFLLITLLLQHRNRLLPQ QSKPRLLPPLGEEDEDVAQERERVTKGATQGDVLVLRDLTK VYRGQRNPAVDR

LCLGIPPGE CFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHN NVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQ TALS

GLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFL DEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHS SMEECEALCTRLAIMVNGRFRC

LGSSQHLKGR RFGAGHTLTLRVPPDQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEE - UNI37

140 - VFLYFSKDQGEEEESSRQEAEEEEVSKPGRQHPKRVSRFLEDPSSVETMI

For any suggestions or comments, please send an email to unitrap@crg.es