Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035762 (Tmem161b)
Chromosomal location
Chr 13: 84361931 - 84435569 (+)
Description
transmembrane protein 161B Gene [Source:MGI Symbol;Acc:MGI:1919995]
RefSeq_dna
NM_175187 
RefSeq_peptide
NP_780396.2 
UniGene
Mm.473248 
MGI
MGI:1919995 
Uniprot/SWISSPROT
Q8C2L6 
Uniprot/SPTREMBL
Q8BPX3 
Human Ortholog
ENSG00000164180 (TMEM161B)
Omim not available
UniTrap UNI4900
Vector Insertion
Chr 13: 84361930 - 84362040
Public Clones AT0180 (sanger) AK0102 (sanger) D028G05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15986
Vector Insertion
Chr 13: 84390939 - 84397365
Public Clones not available
Private Clones OST468524 (lexicon) OST444385 (lexicon) OST389140 (lexicon) OST253155 (lexicon)
OST223559 (lexicon) OST79440 (lexicon) OST56203 (lexicon) OST43692 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27403
Vector Insertion
Chr 13: 84411955 - 84422315
Public Clones not available
Private Clones OST60572 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057495
Sequence
TTTCCCTTCGCGGTTTCGAGAGCTCCGTTTTGCAGAACCTGAAGGGGAGATTCTGGACGGTCCCGGGGACTCTAGACTGTCTGTCCCACGACCTGTTCTT

GGCGTTATG - UNI4900 - GGTGTGATAGGTATACAGCTGGTTGTTACCATGGTGATGGCCAGTGTCATGCAGAAGATTATACCTCACTATTCTCTT

GCTCGATGGCTACTCTGTAATGGCAG - UNI15986 - TTTGAGATGGTATCAACATCCTTCCGAAGAAGAATTAAGAATCCTTGCAGGGAAGCAGCA

GAAAGGAAAAAGTAAAAAAGACAG AAAATACAATGGCCATATTGAAAATAAGCCACTAACCATTCCAAAAGACATTGACCTTCATCTAGAAACCAAGTC

TGTTACAGAAGTGGACACTTTAG CACTGCATTACTTCCCAGAATACCAGTGGCTGGTGGACTTCACGGTGGCTGCTACCATTGTCTATTTAGTAACTGA

GGTCTATTACAGCTTCATGAAGCCTACACAGGAAATGAATATCAGCTTAGTTTGGTGCCTCCTGGTTTTGTCTTTTGCAAT - UNI27403 - CAAAG

TTCTATTTTCATTAACTACACACTATTTTAAAGTAGAAGATGGAGGTGAAAGGTCAGTTTGTGTCACCTTTGGATTTTTTTTCTTCGTTAAAGCAATGGC

AGTTTTGATCGTAACAGAGAACTACCTGGAGTTTGGCCTTGAAACAG GGTTTACAAATTTTTCAGACAGTGCAATGCAGTTTCTTGAAAAGCAGGGTTT

AGAATCTCA GGGCCCTGTTTCAAAACTTACTTTCAAATTTTTCCTGGCTGTTTTCTGTTCACTCATTGGGGCTTTTTTGACATTTCCTGGATTACGGCT

GGCTCAAATGCATCTGGATGCCCTGAATATGGCAACAGAAAAAATTACACA AACATTACTTCATATCAACTTCTTGGCACCTTTATTTATGGTTCTGCT

CTGGGTGAAACCAATCACCAAAGACTATATCATGAACCCACCGTTGGGTAGAGAGAGTGTCCCTCT AATGACAGAAGCCACATTTGATACTCTTCGACT

CTGGTTAATAATCCTGCTCTGTGTTTTGCGGTTGGCCATGATGCGAAGTCACCTGCAAGCATATTTAAATTTGGCCCAGAAATGTGTGGATCAAATGAAG

AAAGAAGCTGGCCGAATAAGTACAGTTGAGCTACAGAAAATG GTGGCGCGAGTCTTTTACTACCTGTGTGTCATTGCCCTGCAGTATGTGGCACCTCTG

GTAATGCTGCTTCATATGACTCTGCTTCTGAAAACACTAG GTAATCATTCCTGGGGAATTTATCCAGAAGCCGCCTTTCCCTTGCCAGTGGATAATAAT

CTCCCCGCCAACTCGGCTTACCCTGAACTACCATCACCTGATGGGAAGATGAAGGTAACTGTTACACAAATCACAGTGGCCCTGAGCAGCTTAAAAAACA

TCTTCACGCCTCTCCTTTTTCGAGGACTTCTGTCATTTTTGACATGGTGGATTGCAGCTTGCCTCTTTTCTACAAGCCTTTTTGGGCTTTTCTATCATCA

GTATTTGACAGTGGCATGAATTTCAGTCAAAAACGGATATCCAAGTCACACTTTAAATTCAAATATCTGTGCCCTTGAAGGATTGACAAAAGAAGAATGC

AAATAGAACGGAGAAAAAAATTATTGGAGTGTTTTGTTTTGAATGCTTCCTCTGTACTCTCAGGGTGAATTAATGTTGTAATATTTAAAACTCATGAGAT

AGGTTGTTACACTGTTACACACTGTGGCATTGGAATTGTAACTCATTGAGAGAACTAATGTGAGAGGGCTCTCTGCAGGGGTAATCCTTCTGATTATCTT

GGTTTACAGTTGCAAACCTCCAACAGTCTGTTAGACTTCTTCTAGGACTCCAGTTACTGACTGCTTTTCATGGTGTTGTGGTACTGTTACTACTCATAGT

TGCTGCCTACAGAACAATCTTCAAACTGAGCCATGCTCGAGGGAAGGGAAAGGAACGAAAATTACTTCTGTTGGTAATGTATTAGTCTTAAAAAAAAATC

CAACAGAAAGGAAGAGAAAGCTACTGTATATTACAGTAAGAAAAGCTGCATAGTCATTTTAAATTGAATGGAGATATAAATTACCTATTGTCTACAAGTA

CTGTTACTTGAGAGTAGCAGGAATATTCTTTTAAAGTGAATGCCACCCAGCTTGAAAGTTCTTTTTAAATGATTGGCCATATGAACATCAGCGGTCTCAC

TGTTAGTTTTGGGCCTTGCTGTATTTTATTTTTTCTTTGATTTTAAATAGTTATGTTTAATCTAAAAATATTTATCAATACTGATCAAATTTGAGAATTA

CTTTGCAATCCTGCTGACTACGTGTATGTATTGTGTATATATTATATATTAAATATATAATATATTGAGGTTATAAAAGATGAAAATATTGAATCCTTAT

AATATTTTAAGTTTCAGAACGTACGTTAAACAATGATTTGAATGAGATGTATTTGTATCTGGAAATTTCTGTTTGGAATGAGATTAAAATACATTTTTTT

AAAGCTCAACAGAGTGTAATTTATTTGTTGTACATATATGATAATAGTACTTAAAATGTCATGAAGATTAGTTGATTTCTCACAAATTAAATTTCATTTT

CTG
Translation
M - UNI4900 - GVIGIQLVVTMVMASVMQKIIPHYSLARWLLCNGS - UNI15986 - SLRWYQHPSEEELRILAGKQQKGKSKKDR RKYNGHI

ENKPLTIPKDIDLHLETKSVTEVDTLA ALHYFPEYQWLVDFTVAATIVYLVTEVYYSFMKPTQEMNISLVWCLLVLSFAI - UNI27403 - IKVLF

SLTTHYFKVEDGGERSVCVTFGFFFFVKAMAVLIVTENYLEFGLETG GFTNFSDSAMQFLEKQGLESQ QGPVSKLTFKFFLAVFCSLIGAFLTFPGLR

LAQMHLDALNMATEKITQ QTLLHINFLAPLFMVLLWVKPITKDYIMNPPLGRESVPL LMTEATFDTLRLWLIILLCVLRLAMMRSHLQAYLNLAQKCV

DQMKKEAGRISTVELQKM VARVFYYLCVIALQYVAPLVMLLHMTLLLKTLG GNHSWGIYPEAAFPLPVDNNLPANSAYPELPSPDGKMKVTVTQITVA

LSSLKNIFTPLLFRGLLSFLTWWIAACLFSTSLFGLFYHQYLTVA
Transcript ENSMUST00000050885
Sequence
TTTCCCTTCGCGGTTTCGAGAGCTCCGTTTTGCAGAACCTGAAGGGGAGATTCTGGACGGTCCCGGGGACTCTAGACTGTCTGTCCCACGACCTGTTCTT

GGCGTTATG - UNI4900 - - UNI15986 - TTTGAGATGGTATCAACATCCTTCCGAAGAAGAATTAAGAATCCTTGCAGGGAAGCAGCAGAAAG

GAAAAAGTAAAAAAGACAG AAAATACAATGGCCATATTGAAAATAAGCCACTAACCATTCCAAAAGACATTGACCTTCATCTAGAAACCAAGTCTGTTA

CAGAAGTGGACACTTTAG CACTGCATTACTTCCCAGAATACCAGTGGCTGGTGGACTTCACGGTGGCTGCTACCATTGTCTATTTAGTAACTGAGGTCT

ATTACAGCTTCATGAAGCCTACACAGGAAATGAATATCAGCTTAGTTTGGTGCCTCCTGGTTTTGTCTTTTGCAATGTATCCTTCAAACCATCATTAA
Translation
SLRGFESSVLQNLKGRFWTVPGTLDCLSHDLFLALC - UNI4900 - - UNI15986 - CLRWYQHPSEEELRILAGKQQKGKSKKDR RKYNGHIE

NKPLTIPKDIDLHLETKSVTEVDTLA ALHYFPEYQWLVDFTVAATIVYLVTEVYYSFMKPTQEMNISLVWCLLVLSFAMYPSNHH

For any suggestions or comments, please send an email to unitrap@crg.es