Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035776 (Cd99l2)
Chromosomal location
Chr X: 68673240 - 68745820 (-)
Description
CD99 antigen-like 2 Gene [Source:MGI (curated);Acc:Cd99l2-006]
RefSeq_dna
NM_138309 
RefSeq_peptide
NP_612182.1 
UniGene
Mm.397118 Mm.422126 Mm.283879 
MGI
MGI:2177151 
Uniprot/SWISSPROT
Q8BIF0 
Uniprot/SPTREMBL
Q8R446 A2AP74 
Human Ortholog
ENSG00000102181 (CD99L2)
Omim not available
UniTrap UNI28496
Vector Insertion
Chr X: 68703849 - 68745696
Public Clones not available
Private Clones OST29654 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000080035
Sequence
CCTCGGGCCCTCCTGCGCTAACTGTGCTCCTCCGGGCCCCTGCGCCTGCTCCCAGCCATGGTGGCCAGGCTCACGGCTTTCCTCGTTTGCCTCGTTTTCT

CCTTGGCCACCCTTGTCCAGAGAG - UNI28496 - GATATGGAGACACAGATGGTTTTAATCTGGAGGATGCACTGAAAGAAACTTCCTCAGTAAAG

C AGAGATGGGACCATGTTGCCACTACTACAACTAGAAGGCCAGGAACAACTAGAGCACCATCAAATCCTATGG AACTAGATGGGTTTGACTTGGAAGA

TGCCTTGGATGATCGAAATGATCTAGATGGTCCCAAAAAGCCAAGTGCAGGAGAAGCAGGAG GTTGGTCAGACAAGGATCTTGAAGACATCGTGGAAGG

TGGGGGATACAAACCTGACAAGAATAAAG GCGGTGGTGGTTATGGCAGCAACGATGACCCTGGATCTG GCATATCGACAGAAACTGGCACCATTGCAG

GTGTGGCCAGTGCCCTTGCTATGGCCCTGATTGGAGCTGTATCCAGCTACATCTCCTACCAGCAGAAGAAGTTTTGCTTCAGCATTCAGC AGGGCCTCA

ATGCAGACTACGTGAAGGGGGAGAACCTGGAAGCTGTTGTGTGTGAGGAGCCCCAAG TGACATACTCAAAACAAGAAACGCAGTCTGCAGAACCCCCAC

CACCCGAGCCACCCCGGATTTGAGGCAGGTACATCTGAAGGAAGCCACCGCTTGTGACCCAGCTCCGGATTTCATTTGCCAATCCTTTCCCCAAGTTTCT

TCCCATGCCACTGGCTGCTTATTGTAGTGAGTTTTCTGGACAAGCCTTAGGTGTTCATGAGTGTGGTTTCTGTGCCCTGTCCTGCAGACTACAGTGACTG

CTCTGCCATGGGTCCTCTAAAGAGACTTGGTTCTGAGACTTGAGACCCACATTCAGCAGATTCCTAGCACCAGCAGTGAAAGTTTCTGGGTGATGGAGAC

AGCTGGATTCAGCCTTAGCATGGGAAAAGGAGGATGCCCAAGGTGGGGGTGGCCCAGAGGATGGTTGGGGCAGCACTGCAGAACGTTTCTGGTTAGGCAG

TCTCTAGGTTCTATGAAATCCTTTGCCTACATGCTGTAGTGGGTTGTTTGTTGTGGTGCTGACCACTGAGAGCTGTGAGGAGCATGCTCAACGGGCATCT

GGTGCATATGGAACCCATTTTAAGACAAATCAGACAGCACCAAGCTGCAACACACATACATGTGTACACACACACACTCACACACACCCTACATGTGTGC

GCACACACACATAACACCTAGGCACTTTTAAAAAATCGATTGTTCTTCCCAACTTCATGTTTCATATTGGTCAGCTTCCAGAGAGCTTGTCCAGGTGAAG

GCTCTTCAGTGATTTTAGTGCAAACATGGTCTCACAATAGTCTTACCCCAAGATTAGAAAGAAGGAGCATATGGGAGCTGTGACTTGCGGTTGGATTCCT

ATCAGACTGTGTAGGGATCTCCGGCTGGCCTGGTTAACAGGTCTTGGAAGTCACCTACAAATGAACTTTCTCCCAGGTCAGGGTGGGTGTTTACACTACC

CTGTACATGATCTTATTTAAGTAGCAAGAGCTACAGATCCTGAGAATGAACGTGGAAACCAGAAGCATGCTTGTTGTTTTATTAGAAGTGGATGGGGAAA

GGGGAAGGTAGGGGAAGGGATACTAGCTTAGCTGCCTTTGTAGTTGTGTAGCTGTCCTCCCTGTCTGCTCTGAAAAGGGCTCTGACCATGTTCATAGCGG

TAAATACAGGAAACCAAGGGCCAGGGCCAGAGCTGACTGCTACCCCTAGTTTGGGCTGGATCTGCCTGCTTCCTGGATTGTTTCTTTGGCTCCAGTGAGC

TTGATAGTGAACCCTGCAGGTGAAAGCTAAGCTAGTTTCCACCCCATATGAACTAATAGTTTGCCACGTCAAACGGCACTTCTGAAAGCAATGTGTGTCA

CTGTGAAGGCAAGATCTACAGCTCCTCTGGACAACATGATTGGCCCCATATATCCCATAAGCTGTGAATTGGCTCCTTCACCTCTGCTGAGCTGGGAAGA

GGCAACACTCACCTTAAGAAACTCCCTAACTCTTGTGCTGTCTAATGCATGCCTTGAGTGTGTTTGCTGTTTAAAGACTATTCTTGGTGGAGGGCTGCTG

GTGGTGTCATGTTTCCAGGCAGCCTGAACACCAACTCCTACTGTATACCTGTGGGCGATGAGATGCCCCCTTTGCTTGGCCTTTGGTCCCAGACGGTCCA

GGTCTGAGGATCCAATAGGGAAGCTGGAGCACTGGGAAAATGACACTAAGATGGAAAAAAAAAAAAGCTCATGGCCTCAGGAAGCCCGCCTTATTCTTCA

GGAGGTTAATAAGCAAAGAAGGCATCACTTGCAAGATGTGTCCGTTTCTAGAACCTCTTAACTTGCTGGTCGGATTGCTGTCAACATTGTCAGGATTGTG

CCTTACTGACACCAAGGACAACAGGAGATGATGGTGCCACCATTTGGCCAGTGCTGGGCTATAGGTGACTTAAAGGAAGGATTTTAGTATTTCTGGTCTG

TTGACATGTAGCTAGCTAGGGTAATCTCAGGAGGGTTGTCTACCTTTATGCTGAGGCCTGTCTGATGGCAAAGCCCTCAAACCCCACGGCCATGATGTAA

AATAAATGCCCTCTTGTTAAACTGTTTTCTCAATAGCACTGGTTCCAGTGAAAAAGAGCTCTAATTTGCTCTCCCTTAGCTACCTCGGTGCCTTTTGCAT

AAAGCCCTTCTGCATAAAACCCATCACTCAGCCCGCAGGCGCTAGCTAAGTGGCTGGACAGGCCTGAGCGGGCCATCGGCCTCCTGTTCATACAGTTTCA

TCCCAGGGGCCGGGCTCCTCCTTCCCACTGGCATTTTATACTTGGTGGGGCATTGTGGCCTGCAGAAGGCTTGGGACTGGTCCTGTAACTGTGTCCCCCC

TGAAGGCTGAGTTGGCCAACTTGGGTTAGTCCCAGGTGACAGAAGGGAGAAACCAAATGAAGCAGAAGAGCCAATTGCCAAGATCAGATCTCGATCAGTG

AAACTTGACAGGAAGAACTTTAAAAATGCTCAACAGTCTCAAGTGGCTTGATGTAGGGGCTCCTACCCTGGTGTAGGACAGGCCCACTGCCTCAGCCACT

TGGGTCGTGGTTAGTACCAGTTCTCTGAGGAAGACATGTTGGAGACTGCCAGAATCCCTGTACATCGTTTTACGTGCTTGTGTCCAAGTGTGAATTGTAA

ATGGTCTAGTGTTTGCATTAAACAAAGTGGACTCTTAA
Translation
MVARLTAFLVCLVFSLATLVQRG - UNI28496 - GYGDTDGFNLEDALKETSSVKQ QRWDHVATTTTRRPGTTRAPSNPME ELDGFDLEDALDDR

NDLDGPKKPSAGEAGG GWSDKDLEDIVEGGGYKPDKNKG GGGGYGSNDDPGSG GISTETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQ QG

LNADYVKGENLEAVVCEEPQV VTYSKQETQSAEPPPPEPPRI
Transcript ENSMUST00000114586
Sequence
GCGCCTGCTCCCAGCCATGGTGGCCAGGCTCACGGCTTTCCTCGTTTGCCTCGTTTTCTCCTTGGCCACCCTTGTCCAGAGAG - UNI28496 - GAT

ATGGAGACACAGATGGTTTTAATCTGGAGGATGCACTGAAAGAAACTTCCTCAGTAAAGC AACTAGATGGGTTTGACTTGGAAGATGCCTTGGATGATC

GAAATGATCTAGATGGTCCCAAAAAGCCAAGTGCAGGAGAAGCAGGAG GTTGGTCAGACAAGGATCTTGAAGACATCGTGGAAGGTGGGGGATACAAAC

CTGACAAGAATAAAG GCGGTGGTGGTTATGGCAGCAACGATGACCCTGGATCTG GCATATCGACAGAAACTGGCACCATTGCAGGTGTGGCCAGTGCC

CTTGCTATGGCCCTGATTGGAGCTGTATCCAGCTACATCTCCTACCAGCAGAAGAAGTTTTGCTTCAGCATTCAGC AGGGCCTCAATGCAGACTACGTG

AAGGGGGAGAACCTGGAAGCTGTTGTGTGTGAGGAGCCCCAAG TGACATACTCAAAACAAGAAACGCAGTCTGCAGAACCCCCACCACCCGAGCCACCC

CGGATTTGAGGCAGGTACATCTGAAGGAAGCCACCGCTTGTGACCCAGCTCCGGATTTCATTTGCCAATCCTTTCCCCAAGTTTCTTCCCATGCCACTGG

CTGCTTATTGTAGTGAGTTTTCTGGACAAGCCTTAGGTGTTCATGAGTGTGGTTTCTGTGCCCTGTCCTGCAGACTACAGTGACTGCTCTGCCATGGGTC

CTCTAAAGAGACTTGGTTCTGAGACTTGAGACCCACATTCAGCAGATTCCTAGCACCAGCAGTGAAAGTTTCTGGGTGATGGAGACAGCTGGATTCAGCC

TTAGCATGGGAAAAGGAGGATGCCCAAGGTGGGGGTGGCCCAGAGGATGGTTGGGGCAGCACTGCAGAACGTTTCTGGTTAGGCAGTCTCTAGGTTCTAT

GAAATCCTTTGCCTACATGCTGTAGTGGGTTGTTTGTTGTGGTGCTGACCACTGAGAGCTGTGAGGAGCATGCTCAACGGGCATCTGGTGCATATGGAAC

CCATTTTAAGACAAATCAGACAGCACCAAGCTGCAACACACATACATGTGTACACACACACACTCACACACACCCTACATGTGTGCGCACACACACATAA

CACCTAGGCACTTTTAAAAAATCGATTGTTCTTCCCAACTTCATGTTTCATATTGGTCAGCTTCCAGAGAGCTTGTCCAGGTGAAGGCTCTTCAGTGATT

TTAGTGCAAACATGGTCTCACAATAGTCTTACCCCAAGATTAGAAAGAAGGAGCATATGGGAGCTGTGACTTGCGGTTGGATTCCTATCAGACTGTGTAG

GGATCTCCGGCTGGCCTGGTTAACAGGTCTTGGAAGTCACCTACAAATGAACTTTCTCCCAGGTCAGGGTGGGTGTTTACACTACCCTGTACATGATCTT

ATTTAAGTAGCAAGAGCTACAGATCCTGAGAATGAACGTGGAAACCAGAAGCATGCTTGTTGTTTTATTAGAAGTGGATGGGGAAAGGGGAAGGTAGGGG

AAGGGATACTAGCTTAGCTGCCTTTGTAGTTGTGTAGCTGTCCTCCCTGTCTGCTCTGAAAAGGGCTCTGACCATGTTCATAGCGGTAAATACAGGAAAC

CAAGGGCCAGGGCCAGAGCTGACTGCTACCCCTAGTTTGGGCTGGATCTGCCTGCTTCCTGGATTGTTTCTTTGGCTCCAGTGAGCTTGATAGTGAACCC

TGCAGGTGAAAGCTAAGCTAGTTTCCACCCCATATGAACTAATAGTTTGCCACGTCAAACGGCACTTCTGAAAGCAATGTGTGTCACTGTGAAGGCAAGA

TCTACAGCTCCTCTGGACAACATGATTGGCCCCATATATCCCATAAGCTGTGAATTGGCTCCTTCACCTCTGCTGAGCTGGGAAGAGGCAACACTCACCT

TAAGAAACTCCCTAACTCTTGTGCTGTCTAATGCATGCCTTGAGTGTGTTTGCTGTTTAAAGACTATTCTTGGTGGAGGGCTGCTGGTGGTGTCATGTTT

CCAGGCAGCCTGAACACCAACTCCTACTGTATACCTGTGGGCGATGAGATGCCCCCTTTGCTTGGCCTTTGGTCCCAGACGGTCCAGGTCTGAGGATCCA

ATAGGGAAGCTGGAGCACTGGGAAAATGACACTAAGATGGAAAAAAAAAAAAGCTCATGGCCTCAGGAAGCCCGCCTTATTCTTCAGGAGGTTAATAAGC

AAAGAAGGCATCACTTGCAAGATGTGTCCGTTTCTAGAACCTCTTAACTTGCTGGTCGGATTGCTGTCAACATTGTCAGGATTGTGCCTTACTGACACCA

AGGACAACAGGAGATGATGGTGCCACCATTTGGCCAGTGCTGGGCTATAGGTGACTTAAAGGAAGGATTTTAGTATTTCTGGTCTGTTGACATGTAGCTA

GCTAGGGTAATCTCAGGAGGGTTGTCTACCTTTATGCTGAGGCCTGTCTGATGGCAAAGCCCTCAAACCCCACGGCCATGATGTAAAATAAATGCCCTCT

TGTTAAACTGTTTTCTCAATAGCACTGGTTCCAGTGAAAAAGAGCTCTAATTTGCTCTCCCTTAGCTACCTCGGTGCCTTTTGCATAAAGCCCTTCTGCA

TAAAACCCATCACTCAGCCCGCAGGCGCTAGCTAAGTGGCTGGACAGGCCTGAGCGGGCCATCGGCCTCCTGTTCATACAGTTTCATCCCAGGGGCCGGG

CTCCTCCTTCCCACTGGCATTTTATACTTGGTGGGGCATTGTGGCCTGCAGAAGGCTTGGGACTGGTCCTGTAACTGTGTCCCCCCTGAAGGCTGAGTTG

GCCAACTTGGGTTAGTCCCAGGTGACAGAAGGGAGAAACCAAATGAAGCAGAAGAGCCAATTGCCAAGATCAGATCTCGATCAGTGAAACTTGACAGGAA

GAACTTTAAAAATGCTCAACAGTCTCAAGTGGCTTGATGTAGGGGCTCCTACCCTGGTGTAGGACAGGCCCACTGCCTCAGCCACTTGGGTCGTGGTTAG

TACCAGTTCTCTGAGGAAGACATGTTGGAGACTGCCAGAATCCCTGTACATCGTTTTACGTGCTTGTGTCCAAGTGTGAATTGTAAATGGTCTAGTGTTT

GCATTAAACAAAGTGGACTCTTAACAGCT
Translation
MVARLTAFLVCLVFSLATLVQRG - UNI28496 - GYGDTDGFNLEDALKETSSVKQ QLDGFDLEDALDDRNDLDGPKKPSAGEAGG GWSDKDLED

IVEGGGYKPDKNKG GGGGYGSNDDPGSG GISTETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQ QGLNADYVKGENLEAVVCEEPQV VTYS

KQETQSAEPPPPEPPRI
Transcript ENSMUST00000114587
Sequence
GCGCCTGCTCCCAGCCATGGTGGCCAGGCTCACGGCTTTCCTCGTTTGCCTCGTTTTCTCCTTGGCCACCCTTGTCCAGAGAG - UNI28496 - AGA

GATGGGACCACTTCAGCACCACGACTAGGAGGCCAGTAACAACCAGAGCCCCAGCAAATCCAGCAG AGAGATGGGACCATGTTGCCACTACTACAACTA

GAAGGCCAGGAACAACTAGAGCACCATCAAATCCTATGG AACTAGATGGGTTTGACTTGGAAGATGCCTTGGATGATCGAAATGATCTAGATGGTCCCA

AAAAGCCAAGTGCAGGAGAAGCAGGAG GTTGGTCAGACAAGGATCTTGAAGACATCGTGGAAGGTGGGGGATACAAACCTGACAAGAATAAAG GCGGT

GGTGGTTATGGCAGCAACGATGACCCTGGATCTG GCATATCGACAGAAACTGGCACCATTGCAGGTGTGGCCAGTGCCCTTGCTATGGCCCTGATTGGA

GCTGTATCCAGCTACATCTCCTACCAGCAGAAGAAGTTTTGCTTCAGCATTCAGC AGGGCCTCAATGCAGACTACGTGAAGGGGGAGAACCTGGAAGCT

GTTGTGTGTGAGGAGCCCCAAG TGACATACTCAAAACAAGAAACGCAGTCTGCAGAACCCCCACCACCCGAGCCACCCCGGATTTGAGGCAGGTACATC

TGAAGGAAGCCACCGCTTGTGACCCAGCTCCGGATTTCATTTGCCAATCCTTTCCCCAAGTTTCTTCCCATGCCACTGGCTGCTTATTGTAGTGAGTTTT

CTGGACAAGCCTTAGGTGTTCATGAGTGTGGTTTCTGTGCCCTGTCCTGCAGACTACAGTGACTGCTCTGCCATGGGTCCTCTAAAGAGACTTGGTTCTG

AGACTTGAGACCCACATTCAGCAGATTCCTAGCACCAGCAGTGAAAGTTTCTGGGTGATGGAGACAGCTGGATTCAGCCTTAGCATGGGAAAAGGAGGAT

GCCCAAGGTGGGGGTGGCCCAGAGGATGGTTGGGGCAGCACTGCAGAACGTTTCTGGTTAGGCAGTCTCTAGGTTCTATGAAATCCTTTGCCTACATGCT

GTAGTGGGTTGTTTGTTGTGGTGCTGACCACTGAGAGCTGTGAGGAGCATGCTCAACGGGCATCTGGTGCATATGGAACCCATTTTAAGACAAATCAGAC

AGCACCAAGCTGCAACACACATACATGTGTACACACACACACTCACACACACCCTACATGTGTGCGCACACACACATAACACCTAGGCACTTTTAAAAAA

TCGATTGTTCTTCCCAACTTCATGTTTCATATTGGTCAGCTTCCAGAGAGCTTGTCCAGGTGAAGGCTCTTCAGTGATTTTAGTGCAAACATGGTCTCAC

AATAGTCTTACCCCAAGATTAGAAAGAAGGAGCATATGGGAGCTGTGACTTGCGGTTGGATTCCTATCAGACTGTGTAGGGATCTCCGGCTGGCCTGGTT

AACAGGTCTTGGAAGTCACCTACAAATGAACTTTCTCCCAGGTCAGGGTGGGTGTTTACACTACCCTGTACATGATCTTATTTAAGTAGCAAGAGCTACA

GATCCTGAGAATGAACGTGGAAACCAGAAGCATGCTTGTTGTTTTATTAGAAGTGGATGGGGAAAGGGGAAGGTAGGGGAAGGGATACTAGCTTAGCTGC

CTTTGTAGTTGTGTAGCTGTCCTCCCTGTCTGCTCTGAAAAGGGCTCTGACCATGTTCATAGCGGTAAATACAGGAAACCAAGGGCCAGGGCCAGAGCTG

ACTGCTACCCCTAGTTTGGGCTGGATCTGCCTGCTTCCTGGATTGTTTCTTTGGCTCCAGTGAGCTTGATAGTGAACCCTGCAGGTGAAAGCTAAGCTAG

TTTCCACCCCATATGAACTAATAGTTTGCCACGTCAAACGGCACTTCTGAAAGCAATGTGTGTCACTGTGAAGGCAAGATCTACAGCTCCTCTGGACAAC

ATGATTGGCCCCATATATCCCATAAGCTGTGAATTGGCTCCTTCACCTCTGCTGAGCTGGGAAGAGGCAACACTCACCTTAAGAAACTCCCTAACTCTTG

TGCTGTCTAATGCATGCCTTGAGTGTGTTTGCTGTTTAAAGACTATTCTTGGTGGAGGGCTGCTGGTGGTGTCATGTTTCCAGGCAGCCTGAACACCAAC

TCCTACTGTATACCTGTGGGCGATGAGATGCCCCCTTTGCTTGGCCTTTGGTCCCAGACGGTCCAGGTCTGAGGATCCAATAGGGAAGCTGGAGCACTGG

GAAAATGACACTAAGATGGAAAAAAAAAAAAGCTCATGGCCTCAGGAAGCCCGCCTTATTCTTCAGGAGGTTAATAAGCAAAGAAGGCATCACTTGCAAG

ATGTGTCCGTTTCTAGAACCTCTTAACTTGCTGGTCGGATTGCTGTCAACATTGTCAGGATTGTGCCTTACTGACACCAAGGACAACAGGAGATGATGGT

GCCACCATTTGGCCAGTGCTGGGCTATAGGTGACTTAAAGGAAGGATTTTAGTATTTCTGGTCTGTTGACATGTAGCTAGCTAGGGTAATCTCAGGAGGG

TTGTCTACCTTTATGCTGAGGCCTGTCTGATGGCAAAGCCCTCAAACCCCACGGCCATGATGTAAAATAAATGCCCTCTTGTTAAACTGTTTTCTCAATA

GCACTGGTTCCAGTGAAAAAGAGCTCTAATTTGCTCTCCCTTAGCTACCTCGGTGCCTTTTGCATAAAGCCCTTCTGCATAAAACCCATCACTCAGCCCG

CAGGCGCTAGCTAAGTGGCTGGACAGGCCTGAGCGGGCCATCGGCCTCCTGTTCATACAGTTTCATCCCAGGGGCCGGGCTCCTCCTTCCCACTGGCATT

TTATACTTGGTGGGGCATTGTGGCCTGCAGAAGGCTTGGGACTGGTCCTGTAACTGTGTCCCCCCTGAAGGCTGAGTTGGCCAACTTGGGTTAGTCCCAG

GTGACAGAAGGGAGAAACCAAATGAAGCAGAAGAGCCAATTGCCAAGATCAGATCTCGATCAGTGAAACTTGACAGGAAGAACTTTAAAAATGCTCAACA

GTCTCAAGTGGCTTGATGTAGGGGCTCCTACCCTGGTGTAGGACAGGCCCACTGCCTCAGCCACTTGGGTCGTGGTTAGTACCAGTTCTCTGAGGAAGAC

ATGTTGGAGACTGCCAGAATCCCTGTACATCGTTTTACGTGCTTGTGTCCAAGTGTGAATTGTAAATGGTCTAGTGTTTGCATTAAACAAAGTGGACTCT

TAACAGCT
Translation
MVARLTAFLVCLVFSLATLVQRE - UNI28496 - ERWDHFSTTTRRPVTTRAPANPAE ERWDHVATTTTRRPGTTRAPSNPME ELDGFDLEDALD

DRNDLDGPKKPSAGEAGG GWSDKDLEDIVEGGGYKPDKNKG GGGGYGSNDDPGSG GISTETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQ 

QGLNADYVKGENLEAVVCEEPQV VTYSKQETQSAEPPPPEPPRI
Transcript ENSMUST00000037391
Sequence
GCGCCTGCTCCCAGCCATGGTGGCCAGGCTCACGGCTTTCCTCGTTTGCCTCGTTTTCTCCTTGGCCACCCTTGTCCAGAGAG - UNI28496 - GAT

ATGGAGACACAGATGGTTTTAATCTGGAGGATGCACTGAAAGAAACTTCCTCAGTAAAGC AGAGATGGGACCACTTCAGCACCACGACTAGGAGGCCAG

TAACAACCAGAGCCCCAGCAAATCCAGCAG AGAGATGGGACCATGTTGCCACTACTACAACTAGAAGGCCAGGAACAACTAGAGCACCATCAAATCCTA

TGG AACTAGATGGGTTTGACTTGGAAGATGCCTTGGATGATCGAAATGATCTAGATGGTCCCAAAAAGCCAAGTGCAGGAGAAGCAGGAG GTTGGTCA

GACAAGGATCTTGAAGACATCGTGGAAGGTGGGGGATACAAACCTGACAAGAATAAAG GCGGTGGTGGTTATGGCAGCAACGATGACCCTGGATCTG G

CATATCGACAGAAACTGGCACCATTGCAGGTGTGGCCAGTGCCCTTGCTATGGCCCTGATTGGAGCTGTATCCAGCTACATCTCCTACCAGCAGAAGAAG

TTTTGCTTCAGCATTCAGC AGGGCCTCAATGCAGACTACGTGAAGGGGGAGAACCTGGAAGCTGTTGTGTGTGAGGAGCCCCAAG TGACATACTCAAA

ACAAGAAACGCAGTCTGCAGAACCCCCACCACCCGAGCCACCCCGGATTTGAGGCAGGTACATCTGAAGGAAGCCACCGCTTGTGACCCAGCTCCGGATT

TCATTTGCCAATCCTTTCCCCAAGTTTCTTCCCATGCCACTGGCTGCTTATTGTAGTGAGTTTTCTGGACAAGCCTTAGGTGTTCATGAGTGTGGTTTCT

GTGCCCTGTCCTGCAGACTACAGTGACTGCTCTGCCATGGGTCCTCTAAAGAGACTTGGTTCTGAGACTTGAGACCCACATTCAGCAGATTCCTAGCACC

AGCAGTGAAAGTTTCTGGGTGATGGAGACAGCTGGATTCAGCCTTAGCATGGGAAAAGGAGGATGCCCAAGGTGGGGGTGGCCCAGAGGATGGTTGGGGC

AGCACTGCAGAACGTTTCTGGTTAGGCAGTCTCTAGGTTCTATGAAATCCTTTGCCTACATGCTGTAGTGGGTTGTTTGTTGTGGTGCTGACCACTGAGA

GCTGTGAGGAGCATGCTCAACGGGCATCTGGTGCATATGGAACCCATTTTAAGACAAATCAGACAGCACCAAGCTGCAACACACATACATGTGTACACAC

ACACACTCACACACACCCTACATGTGTGCGCACACACACATAACACCTAGGCACTTTTAAAAAATCGATTGTTCTTCCCAACTTCATGTTTCATATTGGT

CAGCTTCCAGAGAGCTTGTCCAGGTGAAGGCTCTTCAGTGATTTTAGTGCAAACATGGTCTCACAATAGTCTTACCCCAAGATTAGAAAGAAGGAGCATA

TGGGAGCTGTGACTTGCGGTTGGATTCCTATCAGACTGTGTAGGGATCTCCGGCTGGCCTGGTTAACAGGTCTTGGAAGTCACCTACAAATGAACTTTCT

CCCAGGTCAGGGTGGGTGTTTACACTACCCTGTACATGATCTTATTTAAGTAGCAAGAGCTACAGATCCTGAGAATGAACGTGGAAACCAGAAGCATGCT

TGTTGTTTTATTAGAAGTGGATGGGGAAAGGGGAAGGTAGGGGAAGGGATACTAGCTTAGCTGCCTTTGTAGTTGTGTAGCTGTCCTCCCTGTCTGCTCT

GAAAAGGGCTCTGACCATGTTCATAGCGGTAAATACAGGAAACCAAGGGCCAGGGCCAGAGCTGACTGCTACCCCTAGTTTGGGCTGGATCTGCCTGCTT

CCTGGATTGTTTCTTTGGCTCCAGTGAGCTTGATAGTGAACCCTGCAGGTGAAAGCTAAGCTAGTTTCCACCCCATATGAACTAATAGTTTGCCACGTCA

AACGGCACTTCTGAAAGCAATGTGTGTCACTGTGAAGGCAAGATCTACAGCTCCTCTGGACAACATGATTGGCCCCATATATCCCATAAGCTGTGAATTG

GCTCCTTCACCTCTGCTGAGCTGGGAAGAGGCAACACTCACCTTAAGAAACTCCCTAACTCTTGTGCTGTCTAATGCATGCCTTGAGTGTGTTTGCTGTT

TAAAGACTATTCTTGGTGGAGGGCTGCTGGTGGTGTCATGTTTCCAGGCAGCCTGAACACCAACTCCTACTGTATACCTGTGGGCGATGAGATGCCCCCT

TTGCTTGGCCTTTGGTCCCAGACGGTCCAGGTCTGAGGATCCAATAGGGAAGCTGGAGCACTGGGAAAATGACACTAAGATGGAAAAAAAAAAAAGCTCA

TGGCCTCAGGAAGCCCGCCTTATTCTTCAGGAGGTTAATAAGCAAAGAAGGCATCACTTGCAAGATGTGTCCGTTTCTAGAACCTCTTAACTTGCTGGTC

GGATTGCTGTCAACATTGTCAGGATTGTGCCTTACTGACACCAAGGACAACAGGAGATGATGGTGCCACCATTTGGCCAGTGCTGGGCTATAGGTGACTT

AAAGGAAGGATTTTAGTATTTCTGGTCTGTTGACATGTAGCTAGCTAGGGTAATCTCAGGAGGGTTGTCTACCTTTATGCTGAGGCCTGTCTGATGGCAA

AGCCCTCAAACCCCACGGCCATGATGTAAAATAAATGCCCTCTTGTTAAACTGTTTTCTCAATAGCACTGGTTCCAGTGAAAAAGAGCTCTAATTTGCTC

TCCCTTAGCTACCTCGGTGCCTTTTGCATAAAGCCCTTCTGCATAAAACCCATCACTCAGCCCGCAGGCGCTAGCTAAGTGGCTGGACAGGCCTGAGCGG

GCCATCGGCCTCCTGTTCATACAGTTTCATCCCAGGGGCCGGGCTCCTCCTTCCCACTGGCATTTTATACTTGGTGGGGCATTGTGGCCTGCAGAAGGCT

TGGGACTGGTCCTGTAACTGTGTCCCCCCTGAAGGCTGAGTTGGCCAACTTGGGTTAGTCCCAGGTGACAGAAGGGAGAAACCAAATGAAGCAGAAGAGC

CAATTGCCAAGATCAGATCTCGATCAGTGAAACTTGACAGGAAGAACTTTAAAAATGCTCAACAGTCTCAAGTGGCTTGATGTAGGGGCTCCTACCCTGG

TGTAGGACAGGCCCACTGCCTCAGCCACTTGGGTCGTGGTTAGTACCAGTTCTCTGAGGAAGACATGTTGGAGACTGCCAGAATCCCTGTACATCGTTTT

ACGTGCTTGTGTCCAAGTGTGAATTGTAAATGGTCTAGTGTTTGCATTAAACAAAGTGGACTCTTAACAGCT
Translation
MVARLTAFLVCLVFSLATLVQRG - UNI28496 - GYGDTDGFNLEDALKETSSVKQ QRWDHFSTTTRRPVTTRAPANPAE ERWDHVATTTTRRPG

TTRAPSNPME ELDGFDLEDALDDRNDLDGPKKPSAGEAGG GWSDKDLEDIVEGGGYKPDKNKG GGGGYGSNDDPGSG GISTETGTIAGVASALAMA

LIGAVSSYISYQQKKFCFSIQQ QGLNADYVKGENLEAVVCEEPQV VTYSKQETQSAEPPPPEPPRI

For any suggestions or comments, please send an email to unitrap@crg.es