Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035840 (Lysmd3)
Chromosomal location
Chr 13: 81796805 - 81810887 (+)
Description
LysM, putative peptidoglycan-binding, domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:1915906]
RefSeq_dna
NM_030257 
RefSeq_peptide
NP_084533.1 
UniGene
Mm.259969 Mm.401768 
MGI
MGI:1915906 
Uniprot/SWISSPROT
Q99LE3 
Human Ortholog
ENSG00000176018 (LYSMD3)
Omim not available
UniTrap UNI22303
Vector Insertion
Chr 13: 81796936 - 81804003
Public Clones (ggtc)
Private Clones OST301226 (lexicon) OST206210 (lexicon) OST178184 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049055
Sequence
GCGGCGACGGCGGCGACGGTGGCAGAAGCGGACCCAGACACCGGAGAACCTAGAGTCGGTCATGAACGTCTCCGGGGCCGCGGCTGTGGTGGAGGACATA

ACCGTGTCGCCGCGCCCCTGCTAGAGGACAG - UNI22303 - CTAGAACGTCATGGCGGGGAGGAATCAGAACCGGACGGTTTCCCTCCCAGGAATT

CAGGCCAGTGGCCATGTACTTGCTTTTGGAAATTGTACAGACAATGACATGTTGGAAGAAGATGCTGAAGTCTACGAACTTCGGTCCAGGGGAAAGGAGA

AGGTTCGAAGAAGCGCATCGAGAGATAGACTTGATGACATTGTTATATTAACCAAAGATATCCAGGAAGGAGACACTCTAAACGCAGTAGCCCTTCAGTA

CTGCTGTACG GTAGCAGATATCAAAAGAGTTAACAATCTCATCAGTGATCAAGACTTTTTTGCTCTTAGGTCTATCAAAATTCCAGTTAAAAGGTTTAG

TTCTTTGACTGAAACTCTTCATCCTCTGAAAGGAAGACACATTTTACATCCTCCACCTGTTCCGTATTTTCAAGAGCAAGACATTGTGCCAGCTGATGGT

TCTCTTTCTTCCAGTGAGTCAGCCGGCAGTTTCCTAAAAGAAGTGGACCGAGACATAGAACAAATAGTCAAGTGTACAGACACCAAGAAGGAGAACCTGA

ATGAAGTCGTGTCTGCCTTAACAGCACAACAGGTCCGATTTGAACCTGATAACAAAAGCATTCACCGAAAGGATCCGTATTACGGAGCAGACTGGGGGAT

TGGTTGGTGGACAGCTGTAGTGATAATGTTGATAGTGGGTATAATAACACCAGTGTTTTATCTGCTGTATTATGAAATTTTAGCTAAAGTGGATGTTAGT

CACCATTCAACAGTGGGTTCTTCACACTTGCATCCAGGACTCACACCTCCAACACAGCACAGAGAGATGGAAAATGAAATTGGTCCAACAAAAGGAATAC

CTGTTGGTCAGCAAGATGACCACAAACTATATAGGCAAGACCCTCAGGCACATGATGCTCAACACAAAACGTAACAGTGAGCTGCATCAGTGTTAGTGGT

CATGTGTGCATATGGAATATGGTGACTCACATGCATCCGACAACTGCTTCGAAGTCGGAATCTAGGACATCGAAGATGGTTTGTTTTTACCTTTCTAAAA

AATCCCTGAACTTTTACAAATGGACTGTCTATAGCACCTGCATATGCTATATTGAGGCTGGTCAGGCCGTACCCCTGCTATATCAGGGCTTAAAGCAGAA

ATAATTTAAATGTATGTCTAGGAATTCTAACTTAGAAGACGCTGTCATTTTTCTTACTCAAGATTAGTTATGTTTAAATTTTAACTTTTAAAAGATTACC

TTTTAGTTTGTTGTTCATGTCAAGGATTCCAAATGCTTACAACTGAAGAAAATTTGATACCATACCTACCACCAAAATATTAATTATAAAAGTTTTAATT

CTAAAATTATTCCTGACACCAAGTACTTAACACTTAAATCTGAAACTTTAAAAATATGTTTAGCATATGTGCCATGAAAGCAAATGTAGAAACAGATATG

GAAACATAGTTTATAATTTGCATAATACAGGCTAAGAAATAGATATCTTAAGACCCCCCAAATAGTGTCATTGGGTTGGAAACTTCCCATTTGATCACAC

GGACACTGTAATTCGTCAAGATCTATTCCTTAAAAAAAGGAATCCTTTATGACTAGCTCTGCAACCTCACCTCCACTTCTTCATTTTTAAAAATACTTGT

GTCTGATATTTGAAGGCACTTTTGTAGTTCTTTGATGAAGTGTTACACAGAAAAGTATATTCAGCAAATCCCTCTTTATATACTCAACATACTTATTGCT

GTTATAAATAGTAACTTATGCCTTAATTAACACCTAACGCCTTACAAAGTTACTTAACGTAAGTTCATGTACACTTCACAATCAAAGTTTGTGTCAGATT

TTATTGAATAGGCTATCATTTCACAGGCTATATACATTTGTCTGTCTTCACTTTTGAGCATAAATGAATGAAGGAAAAACAAATTTGTACAACCTGCCTC

TGAAGTCTTGCAGAAGAAAATGATTCATTAAGCAAAAATGAGTAAGCAAGACTTTTACACTAGCAGTAGACGGGTTGCTTTATTCGGCACTCTGTTGACC

TCTGCTTTTCCAAAAAGAACCTGTCCAATTTAGATTATCCTCCTAATGTGCATCATCCAATGGAGAAACATATGCCAAGGTGTGTGGCGTGGTCAAAAGG

GCTTAATAGTGGCATTTTCTACATCTAATGTGGGACAAGCAATTTGGCTAATTAGTATGTATTCTAAAAATACACTTTTAGGGAGTGGGGTCTGATTTGC

GTGGGTTTTGTGAAATAAAGTGCAGACCGTAAAATATGTCACATTACCTCATTTTTTAGACTCTATTTCCTAAATCAATGTTTCAGCTTTTTAAACATTT

TGTATAACAAATTCCAATCCTGATACAAGGAATTATTAATATCTATTTGTTATATTTGGGATTTTATATGCTTTCAGAAGAAAAAGCATTACAAAAAGAC

TGACATGGAAGTCAGTCATTTTAAGGCCCCTACATCAGAGCAGTTTTAGAAATTTTTCCTTATTTAGTAATAGGTACATTTTGATAAATTGATCCTTGAG

TAAATCTTATTAAAAATAATTTTTTCACATACCATGTGCATTTTGAAATCAGAGTGATCTTTAATTATGTTCAGTGTTAACACAGCCAGTTTACATTTTA

CCTATATTAAGCCTGCTGAAAAAAATCAAGTTTTATAGTAAAAAAAAAAAAAAATGCAGATTTCAGGGCAGAACAGGCTACATAACCTCTTTTTCCATCA

AATAGAGTTGTGATTCTTTTATAGGTGGTTTTACTTGGAATTGTGATCGAAGGGTCTGATCACTTATATTTAAAGGAGTAGGTATATTTGCTGGTTAAAA

TAGTTTCTGTCTTGAGCACTCTTTCTGAAGGAAATACAACATATATCCTTAGGACACAACCAAGCAATTTCCTTTTCCTATATATCTTAGAATCATTAAT

AGAATATGATTCGATATGTAGAATTATGCTTTCATCTTT
Translation
 - UNI22303 - MAGRNQNRTVSLPGIQASGHVLAFGNCTDNDMLEEDAEVYELRSRGKEKVRRSASRDRLDDIVILTKDIQEGDTLNAVALQYCCT 

VADIKRVNNLISDQDFFALRSIKIPVKRFSSLTETLHPLKGRHILHPPPVPYFQEQDIVPADGSLSSSESAGSFLKEVDRDIEQIVKCTDTKKENLNEVV

SALTAQQVRFEPDNKSIHRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYYEILAKVDVSHHSTVGSSHLHPGLTPPTQHREMENEIGPTKGIPVGQ

QDDHKLYRQDPQAHDAQHKT

For any suggestions or comments, please send an email to unitrap@crg.es