Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035864 (Syt1)
Chromosomal location
Chr 10: 107934706 - 108448031 (-)
Description
synaptotagmin I Gene [Source:MGI (curated);Acc:Syt1-001]
RefSeq_dna
NM_009306 
RefSeq_peptide
NP_033332.1 
UniGene
Mm.289702 
MGI
MGI:99667 
Uniprot/SWISSPROT
P46096 
Uniprot/SPTREMBL
Q3TPT3 
Human Ortholog
not available
Omim not available
UniTrap UNI38455
Vector Insertion
Chr 10: 108079269 - 108128120
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34865
Vector Insertion
Chr 10: 107941452 - 108021048
Public Clones IST13918A12 (tigm) IST13114H4 (tigm) IST11231H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105276
Sequence
TCCTCACTGGAGGGATTCCTGGAGAAGCTGCAGTGTGGGGATGCTCTGACCGAGTTCAGCCCCCAGTGTCTTTCCTCCTCCTCCTCCTGCAGCGACAGCA

TCCGCAGTTAGCAGTGGGCAACTTGAGGCTGTAACCGGGGCAAGCCCCCAGGGTCCTGCTCACCCAACAGGGGGCTCAGGTCCCCGAAGGGGTGTGTGCA

GGGCGGGGGCGGCCAGCTGGGACCAGCTGGTGGCCCTAGAAAACCTCACCCACACCCACACCCACACACCCCTTTTGTGTTGCAGGCTGCCCCTCTGAGA

GCGGAGGCAGCGAGAGAGTACTCGTGTGCCTCGCACCGGTCCGCGGTGAGAGCAGCGGGGACCAAGACTCGCACCATCTCCCGGTCGGTCCTCGCTCCAG

 TTTCCCTCTGAATCCTACACTTCATATGTAGACACCTTACTCAACTGGCATTTGTTAGTCAAGTCTCCTCTGCATCCAAG GAAAAGAAGACTTTGGCG

CGCTCGAACAACCAACATCCGCAGTCTGATCAGAAGACATTGCCCTTGCCGTCCCGAGAGCTCCAGCAGAACATCTCGTTAAG ATTGAAGAAAGGAGAT

TCCAAAAGGAACAAAAAAACCCAAATACTCCAGACTACCCCAGCAGAACA TTCCGCTTGAACCAAAAATGGTGAGTGCCAGTCGTCCTGAGGCCCTGGC

TGCCCCTGTCACCACTGTTGCGACCCTTGTCCCACACAACGCCACTGAGCCAGCCAGTCCTGGGGAAGGGAAGGAAGATGCCTTTTCCAAGCTGAAGCAG

AAGTTTATGAATGAACTGCATAAAATCCCAT TGCCACCGTGGGCCTTAATTGCCATAGCCATAGTTGCGGTCCTTCTAGTCGTGACCTGCTGCTTCTGT

GTCTGTAAGAAATGTTTGTTCAAAAAGAAAAACAAGAAGAAGGGAAAGGAAAAGGGAGGGAAGAACGCCATTAACATGAAAGACGTGAAAGACTTAGGGA

AGACCATGAAGGATCAG GCCCTTAAGGATGACGATGCTGAAACTGGACTGACTGATGGAGAAGAAAAGGAGGAGCCCAAGGAAGAGGAGAAACTGGGAA

AGCTTCAATATTCACTGGACTATGACTTCCAGAATAACCAG CTGCTGGTGGGAATCATCCAGGCTGCTGAACTGCCCGCCCTGGACATGGGAGGCACAT

CTGATCCATACGTCAAAGTCTTCCTGCTGCCCGACAAAAAGAAGAAGTTTGAGACAAAAGTCCACCGGAAAACCCTCAATCCAGTCTTCAATGAACAGTT

TACTTTCAAG GTGCCATACTCGGAATTAGGTGGCAAGACACTGGTGATGGCTGTGTATGATTTTGACCGCTTCTCCAAGCACGACATCATTGGAGAGTT

CAAAGTTCCTATGAACACCGTGGATTTTGGCCACGTCACCGAGGAGTGGCGCGATCTCCAGAGTGCTGAGAAAGAAGAG - UNI34865 - CAAGAGA

AACTGGGTGACATCTGCTTCTCCCTCCGCTACGTCCCTACTGCCGGCAAGCTGACTGTTGTCATTCTGGAAGCCAAGAACCTGAAGAAGATGGATGTGGG

TGGCTTATCTG - UNI34865 - ATCCCTATGTAAAGATTCACCTGATGCAGAACGGCAAGAGACTGAAGAAGAAAAAGACAACGATTAAGAAGAACA

CACTTAACCCCTACTACAATGAGTCCTTCAGCTTTGAAGTTCCGTTCGAGCAAATCCAG - UNI34865 - AAAGTGCAAGTGGTGGTAACTGTTTTG

GACTATGACAAGATTGGCAAGAACGACGCCATCGGCAAAGTCTTTGTGGGCTACAACAGCACCGGCGCAGAGCTGCGACACTGGTCAGACATGCTGGCCA

ACCCCCGGCGACCCATCGCCCAGTGGCACACTCTGCAGGTAGAGGAGGAGGTTGATGCCATGCTGGCTGTCAAGAAGTAAAGGGGAAAAGAAGCCTTTCT

GCGTCTGCCCACATAGTGCTCTTTAGCCAGTATCTGTAAATACCTCAGTAATATGGGTCCTTTCAGTTTCCAGCCATGCATTCCTGATACAATCCAGTGG

TACTTCAGATCCTGTTTTAATTTGCACAAATTTAAGTGTAGAAAGCCCCTATGCCCTTCATCATACCACTGCCCTCCAAATCTACTCTTCTTTTAAGCAA

TATGATGTGTAGATAGAGCATGACTGAAATGTATTGTATCACACCGTTGTATATACCAGTATGCTAAAGATTTATTTCTAGTTTGTGTATTTGTATGTTG

TAAGCGTTTCCTAATCTGTGTATATCTAGATGTTTTTAATAAGATGTTCTATTTTAAACTATGTAAATTGACTGAGATATAGGAGAACTGATAATATATT

ATATGGTAAATATAGTATCGTCTGCATTCCAGCAAAAATATCAATTTGAAAGGCACTAGTACAGTTAAACCAACATCTTAAAGGACAACTTAAACCTGAA

CTTTCTATTGAATCCTTTGAGTACCAAGATTTGCTCACATGACATCTTTGATGGGTGAACCCAATTTTGTAGAATTCTTTCACAGGCAAATAGCATGTTC

TGAGCAGCATCCATGCTGACCTCAAGGAAGCAAAGCCACAAACCAGAATAGCATCTGTCTGTCTGTCTCTGCAAAGCTAAAAAATCATGGCTTCACTCTT

CCAGTCAAGGAAGCAACGAACACGAAGGAGCCAGTGAGTTCCTACGACTGCATCTAGCATAGCATAACCGTGGTGTTCTCTGTGTGTGCGTGTGCAAGTG

TGAAAGTGTATGCACGAGTCTTATGTGTGGTGCATGCCTTTGTTCGGGGTTGGGGTGGGAGAGGAGAAGCTGAGAGAAGTCAGCGTTTCTGAAATGTTGC

CTGACTACTTAAACAGAAACTAATAGCTCTCCAGTATCACATTTATATAACACGTGCAACCTGGGAATTCTGGTCCAGATTTCACCCCAATATTGATTCC

AAAAGGTATGCACGTGAGACTTTGTAACAAAATATTTTATTATATAAAACCAGATTAGAAGGAATGCAGAATATTTTTAACACAGCAATCTGTGCTTATT

CCACAACATTACTTTGTGGTAAACAGACAGTATTGTAATCCCATGAAAAGATGAAATATAACAATTAGCCATAGTTCTGAATGCACTTCGATTAAGCCAA

AACAGACAGCTAGTGATCTTTTTATATGCTCTTTTTACTTAAGTTTTAATTTGTCCTTTAAACAAAGGTGAAAAAAAAAACCAAGAACAAGTTCTAGCAA

ACTGAAGCAACCTCTTATGTACACTAGATGCTTGACTTAGGAGGAGTTTTTAAATGTTCTCAATGTTATTCTGTAGTAAATGGCACTATTATGAAGCCAC

TAGTCATTCCATATGAGTCTTAAGGACTGCTCTGTGTAACACTGTGACTGCCCTGTGTGCTTAGACACGTAGTTTCCTCAGTGGCTAGCACCCAACTTAC

TCCGTAGTGATATTGTAACAATACTGCCATTCCCTCGTACTGCACTGCCCAATGTGTGTGTAGCACAAACAGTTCTCATTCTTAAGGACCAATTCAGAAC

TGAACAGCTATGCATAGGACAGAAAGATACATAGACTGGGGGGGTGGGGAGAACACACAGCATCTTGTCAACACTGTGCACTAGTCCACATTTGTCTCGC

TGAGGTAGACAGCCACTTCAGGAAGGTGAGCCTGCTACCTAACACTGCTTCTAGACTCTTCGCCCACTTGATAGTGCGGCCTGTTTTCACCTCCAGGTCA

CAGAAAACAGCAACATCCTGACGGGAGAGGACCATCTTCACATCTACCAAAATAAAATGGAGGCATGGAAAGTGTGGCCTCCTGTTTGATCTATAGGATT

TAGCTCCATGCTTTGGACAAAAGTCAAGAGAATCCCAGAAAGGGCTCTTGGTAGACTTTAAACATGGGGTTGGCCGTTCCTCCTGCACACACAACACAAT

CTCCAAACCCTGGTTCTTCCCTCATTGGAGAAGAGGCAAAGCCTTTGCTCCTCACCTCCATCCCAGCAAACTCTTCAGAATTAGAACAGATGCAGAGGAC

AAGGAGAAAATCCTTTCCTGTGGACGAACAGCACATTTTCAACATTAAAACCACAGATGATAGGAAAGGCACACTCATAGGTGAGATTAAACAGGAGACT

CAAATGAGGGGCTTTCCTACTTAAGGGACCAAGTCCTACCAAAGAGAAGGAGTTGACTTTAAAAAAAAAAATACCTTAGATACCAGACACCGACATTTCG

GTTCACCACCTCCCGACTTAAGTTGTACACGGTGGAGCAACATTTCCAAGGAAGCAGCTTCCAGCTGCCCAAGCAGACATTCCTTCCTGCATCACAACAC

TACTAGCACATTCTCTTGCAACACTGCCAACGTGGGATTGTCACCATAGACTTAGTTGGTACTATATCATCTCCCATGAGCCGGTGACTGGACCTGCTTC

CTGACCTGCCATCCATCCTCAGATGAGCCACCTGTACCCTTCTGACAGTGCAGTGTGAAGTCTTAGAAGCTGATGCCCTAGAAAGATCCTAGTTGCCTTT

GTTGCATATATTTACTGCCTGCTTGAGTGTTTCTCTGTGTGGGTTCTCTCTGTGTCTCGTAGAAATGTTGGGGTGTTTTCTTCTGCCATAAGGGCTCGTG

GCCCGCGAGCCAACTCCTTTAGCTGTATTCTTCCTTCATTTTTTGATAAGTGGTTTAAATTCTGTTTCACTTTGTGTAGTGAACCCCATGGTAGTTTTCT

GATCGTTGTTAAAAAAAATGACTTAACATATTACATGGACACTCAATAAAAATGTTTTATTTCCTGTTGA
Translation
    MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPL LPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKE

KGGKNAINMKDVKDLGKTMKDQ ALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQ LLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKK

FETKVHRKTLNPVFNEQFTFK VPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEE - UNI34865 - QEKLGDIC

FSLRYVPTAGKLTVVILEAKNLKKMDVGGLSD - UNI34865 - DPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQ - UNI348

65 - KVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Transcript ENSMUST00000064054
Sequence
GAGGGATTCCTGGAGAAGCTGCAGTGTGGGGATGCTCTGACCGAGTTCAGCCCCCAGTGTCTTTCCTCCTCCTCCTCCTGCAGCGACAGCATCCGCAGTT

AGCAGTGGGCAACTTGAGGCTGTAACCGGGGCAAGCCCCCAGGGTCCTGCTCACCCAACAGGGGGCTCAGGTCCCCGAAGGGGTGTGTGCAGGGCGGGGG

CGGCCAGCTGGGACCAGCTGGTGGCCCTAGAAAACCTCACCCACACCCACACCCACACACCCCTTTTGTGTTGCAGGCTGCCCCTCTGAGAGCGGAGGCA

GCGAGAGAGTACTCGTGTGCCTCGCACCGGTCCGCGGTGAGAGCAGCGGGGACCAAGACTCGCACCATCTCCCGGTCGGTCCTCGCTCCAG GAAAAGAA

GACTTTGGCGCGCTCGAACAACCAACATCCGCAGTCTGATCAGAAGACATTGCCCTTGCCGTCCCGAGAGCTCCAGCAGAACATCTCGTTAAG ATTGAA

GAAAGGAGATTCCAAAAGGAACAAAAAAACCCAAATACTCCAGACTACCCCAGCAGAACA TTCCGCTTGAACCAAAAATGGTGAGTGCCAGTCGTCCTG

AGGCCCTGGCTGCCCCTGTCACCACTGTTGCGACCCTTGTCCCACACAACGCCACTGAGCCAGCCAGTCCTGGGGAAGGGAAGGAAGATGCCTTTTCCAA

GCTGAAGCAGAAGTTTATGAATGAACTGCATAAAATCCCAT TGCCACCGTGGGCCTTAATTGCCATAGCCATAGTTGCGGTCCTTCTAGTCGTGACCTG

CTGCTTCTGTGTCTGTAAGAAATGTTTGTTCAAAAAGAAAAACAAGAAGAAGGGAAAGGAAAAGGGAGGGAAGAACGCCATTAACATGAAAGACGTGAAA

GACTTAGGGAAGACCATGAAGGATCAG GCCCTTAAGGATGACGATGCTGAAACTGGACTGACTGATGGAGAAGAAAAGGAGGAGCCCAAGGAAGAGGAG

AAACTGGGAAAGCTTCAATATTCACTGGACTATGACTTCCAGAATAACCAG CTGCTGGTGGGAATCATCCAGGCTGCTGAACTGCCCGCCCTGGACATG

GGAGGCACATCTGATCCATACGTCAAAGTCTTCCTGCTGCCCGACAAAAAGAAGAAGTTTGAGACAAAAGTCCACCGGAAAACCCTCAATCCAGTCTTCA

ATGAACAGTTTACTTTCAAG GTGCCATACTCGGAATTAGGTGGCAAGACACTGGTGATGGCTGTGTATGATTTTGACCGCTTCTCCAAGCACGACATCA

TTGGAGAGTTCAAAGTTCCTATGAACACCGTGGATTTTGGCCACGTCACCGAGGAGTGGCGCGATCTCCAGAGTGCTGAGAAAGAAGAG - UNI34865

 - CAAGAGAAACTGGGTGACATCTGCTTCTCCCTCCGCTACGTCCCTACTGCCGGCAAGCTGACTGTTGTCATTCTGGAAGCCAAGAACCTGAAGAAGA

TGGATGTGGGTGGCTTATCTG - UNI34865 - ATCCCTATGTAAAGATTCACCTGATGCAGAACGGCAAGAGACTGAAGAAGAAAAAGACAACGATT

AAGAAGAACACACTTAACCCCTACTACAATGAGTCCTTCAGCTTTGAAGTTCCGTTCGAGCAAATCCAG - UNI34865 - AAAGTGCAAGTGGTGGT

AACTGTTTTGGACTATGACAAGATTGGCAAGAACGACGCCATCGGCAAAGTCTTTGTGGGCTACAACAGCACCGGCGCAGAGCTGCGACACTGGTCAGAC

ATGCTGGCCAACCCCCGGCGACCCATCGCCCAGTGGCACACTCTGCAGGTAGAGGAGGAGGTTGATGCCATGCTGGCTGTCAAGAAGTAAAGGGGAAAAG

AAGCCTTTCTGCGTCTGCCCACATAGTGCTCTTTAGCCAGTATCTGTAAATACCTCAGTAATATGGGTCCTTTCAGTTTCCAGCCATGCATTCCTGATAC

AATCCAGTGGTACTTCAGATCCTGTTTTAATTTGCACAAATTTAAGTGTAGAAAGCCCCTATGCCCTTCATCATACCACTGCCCTCCAAATCTACTCTTC

TTTTAAGCAATATGATGTGTAGATAGAGCATGACTGAAATGTATTGTATCACACCGTTGTATATACCAGTATGCTAAAGATTTATTTCTAGTTTGTGTAT

TTGTATGTTGTAAGCGTTTCCTAATCTGTGTATATCTAGATGTTTTTAATAAGATGTTCTATTTTAAACTATGTAAATTGACTGAGATATAGGAGAACTG

ATAATATATTATATGGTAAATATAGTATCGTCTGCATTCCAGCAAAAATATCAATTTGAAAGGCACTAGTACAGTTAAACCAACATCTTAAAGGACAACT

TAAACCTGAACTTTCTATTGAATCCTTTGAGTACCAAGATTTGCTCACATGACATCTTTGATGGGTGAACCCAATTTTGTAGAATTCTTTCACAGGCAAA

TAGCATGTTCTGAGCAGCATCCATGCTGACCTCAAGGAAGCAAAGCCACAAACCAGAATAGCATCTGTCTGTCTGTCTCTGCAAAGCTAAAAAATCATGG

CTTCACTCTTCCAGTCAAGGAAGCAACGAACACGAAGGAGCCAGTGAGTTCCTACGACTGCATCTAGCATAGCATAACCGTGGTGTTCTCTGTGTGTGCG

TGTGCAAGTGTGAAAGTGTATGCACGAGTCTTATGTGTGGTGCATGCCTTTGTTCGGGGTTGGGGTGGGAGAGGAGAAGCTGAGAGAAGTCAGCGTTTCT

GAAATGTTGCCTGACTACTTAAACAGAAACTAATAGCTCTCCAGTATCACATTTATATAACACGTGCAACCTGGGAATTCTGGTCCAGATTTCACCCCAA

TATTGATTCCAAAAGGTATGCACGTGAGACTTTGTAACAAAATATTTTATTATATAAAACCAGATTAGAAGGAATGCAGAATATTTTTAACACAGCAATC

TGTGCTTATTCCACAACATTACTTTGTGGTAAACAGACAGTATTGTAATCCCATGAAAAGATGAAATATAACAATTAGCCATAGTTCTGAATGCACTTCG

ATTAAGCCAAAACAGACAGCTAGTGATCTTTTTATATGCTCTTTTTACTTAAGTTTTAATTTGTCCTTTAAACAAAGGTGAAAAAAAAAACCAAGAACAA

GTTCTAGCAAACTGAAGCAACCTCTTATGTACACTAGATGCTTGACTTAGGAGGAGTTTTTAAATGTTCTCAATGTTATTCTGTAGTAAATGGCACTATT

ATGAAGCCACTAGTCATTCCATATGAGTCTTAAGGACTGCTCTGTGTAACACTGTGACTGCCCTGTGTGCTTAGACACGTAGTTTCCTCAGTGGCTAGCA

CCCAACTTACTCCGTAGTGATATTGTAACAATACTGCCATTCCCTCGTACTGCACTGCCCAATGTGTGTGTAGCACAAACAGTTCTCATTCTTAAGGACC

AATTCAGAACTGAACAGCTATGCATAGGACAGAAAGATACATAGACTGGGGGGGTGGGGAGAACACACAGCATCTTGTCAACACTGTGCACTAGTCCACA

TTTGTCTCGCTGAGGTAGACAGCCACTTCAGGAAGGTGAGCCTGCTACCTAACACTGCTTCTAGACTCTTCGCCCACTTGATAGTGCGGCCTGTTTTCAC

CTCCAGGTCACAGAAAACAGCAACATCCTGACGGGAGAGGACCATCTTCACATCTACCAAAATAAAATGGAGGCATGGAAAGTGTGGCCTCCTGTTTGAT

CTATAGGATTTAGCTCCATGCTTTGGACAAAAGTCAAGAGAATCCCAGAAAGGGCTCTTGGTAGACTTTAAACATGGGGTTGGCCGTTCCTCCTGCACAC

ACAACACAATCTCCAAACCCTGGTTCTTCCCTCATTGGAGAAGAGGCAAAGCCTTTGCTCCTCACCTCCATCCCAGCAAACTCTTCAGAATTAGAACAGA

TGCAGAGGACAAGGAGAAAATCCTTTCCTGTGGACGAACAGCACATTTTCAACATTAAAACCACAGATGATAGGAAAGGCACACTCATAGGTGAGATTAA

ACAGGAGACTCAAATGAGGGGCTTTCCTACTTAAGGGACCAAGTCCTACCAAAGAGAAGGAGTTGACTTTAAAAAAAAAAATACCTTAGATACCAGACAC

CGACATTTCGGTTCACCACCTCCCGACTTAAGTTGTACACGGTGGAGCAACATTTCCAAGGAAGCAGCTTCCAGCTGCCCAAGCAGACATTCCTTCCTGC

ATCACAACACTACTAGCACATTCTCTTGCAACACTGCCAACGTGGGATTGTCACCATAGACTTAGTTGGTACTATATCATCTCCCATGAGCCGGTGACTG

GACCTGCTTCCTGACCTGCCATCCATCCTCAGATGAGCCACCTGTACCCTTCTGACAGTGCAGTGTGAAGTCTTAGAAGCTGATGCCCTAGAAAGATCCT

AGTTGCCTTTGTTGCATATATTTACTGCCTGCTTGAGTGTTTCTCTGTGTGGGTTCTCTCTGTGTCTCGTAGAAATGTTGGGGTGTTTTCTTCTGCCATA

AGGGCTCGTGGCCCGCGAGCCAACTCCTTTAGCTGTATTCTTCCTTCATTTTTTGATAAGTGGTTTAAATTCTGTTTCACTTTGTGTAGTGAACCCCATG

GTAGTTTTCTGATCGTTGTTAAAAAAAATGACTTAACATATTACATGGACACTCAATAAAAATGTTTTATTTCCTGTT
Translation
   MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPL LPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEK

GGKNAINMKDVKDLGKTMKDQ ALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQ LLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKF

ETKVHRKTLNPVFNEQFTFK VPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEE - UNI34865 - QEKLGDICF

SLRYVPTAGKLTVVILEAKNLKKMDVGGLSD - UNI34865 - DPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQ - UNI3486

5 - KVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

For any suggestions or comments, please send an email to unitrap@crg.es