Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035877 (Zhx3)
Chromosomal location
Chr 2: 160591518 - 160698726 (-)
Description
zinc fingers and homeoboxes 3 Gene [Source:MGI (curated);Acc:Zhx3-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35435
Vector Insertion
Chr 2: 160604960 - 160658155
Public Clones IST12256A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109460
Sequence
CCGAGCTCGGCCGAGCGGCCGGGAGTCAGTTGGTGCTGCTCGTCTTCGCCCCAGAAGCAGTCCGTGGATCTGGCGTCGCCACCGCCGCCGCCGCCGCCTC

CGCGGGGCCTGTGCCGGCCGGCCGCCCACCAAGGAAGGAGGGAGGCTCGCGGCGTGGGGAGAGCAGCGGGGGCCACGGGTGCCGCCGCCGCCGCCGCCAG

 - UNI35435 - GGCTGAATTGCAGCTACAGAGGCAGCAAACGACTCCTTAAAGATGCCACAGGACTGCAGAAAGTGAAGGGGACCTTGGAGAAGATG

ATGAAGGAAAAAGAATGTTTCTCCCAAGGACAAGAA - UNI35435 - GCTTAAGGAAAAGTGGCTTTCTGCAAATAACTGACAAAACTGACCTTAGA

AGCACTTCCCAGGGCCTCATGGAGTAGCTGGAATTTGTACTACAAGGCTTTCTTGCCTACTGGTTACCTGAAGTGGTTGTCGCCATGGCCAGCAAAAGGA

AGTCCACCACCCCATGCATGATCCCCGTTAAGACCGTGGTGCTGCCGGGTGCCAGCACAGAGCCTCAGCCTGTGGAGTCTCTGCCTGAAGGTCCCCAGCA

GGATCTTCCCTCAGAGGCACCTGATGCGAGCAGCGAGGCAGCCCCAAACCCCAGCAGCACTGATGGCTCTGCCCTGGCAAATGGGCACCGGAGCACTTTG

GATGGCTATGTATATTGCTGTAAAGAGTGTGAGTTCAGGTCCCAGGATGTGACCCACTTTATAGGACATATGAACTCAGAGCACACAGACTTTAATAAAG

ACCCAACTTTTGTATGTACAGGGTGCAGTTTCCTGGCAAAAAACCCTGAAGGACTTTCCCTGCATAATGCCAAGTGTCACTCAGGGGAAGCCAGCTTTTT

GTGGAATGTGACCAAGCCAGACAATCATGTAGTAGTGGAGCAGAGTGTCCCTGACAGTGCTAGCTCATCTGTCCTAGCAGGTGAGTCTACTACGGAAGGG

ACTGAAATCATCATTACCAAGACTCCAATCATGAAGATAATGAAAGGCAAAGCTGAAGCCAAAAAAATCCATATGCTTAAAGAGAACGCTCCTAATCAGC

CTGGGAGTGAGGCCTTGCCTAAGCCATTGGCAGGGGAGAGAGAGGTTAAAGAGGGGGACCACACTTTCATCAATGGGGCAGCTCCAGGCAGTCAGGCATC

TGCTAAGTCCACAAAACCCCCTCCTGCTGCCAATGGGCCCCTGATAGGAACAGTGCCTGTCTTGCCAGCTGGTATAGCACAGTTCCTCTCCCTCCAGCAG

CAGCCCCCAGTACATGCCCAACACCACACCCACCAACCCCTGCCTACATCCAAGACCCTTCCGAAAGTCATGATCCCCTTGAGCAGCATCCCAACATATA

ATGCAGCTATGGACTCCAACAGCTTTCTGAAGAACTCCTTCCACAAATTCCCCTACCCAACCAAAGCTGAGCTCTGCTATTTGACTGTGGTGACCAAGTA

TCCAGAAGAACAGCTTAAAATCTGGTTCACAGCCCAGAGGCTGAAGCAAGGAATCAGCTGGTCTCCTGAGGAGATTGAAGATGCCAGGAAAAAGATGTTC

AATACAGTCATCCAGTCTGTGCCTCAGCCCACAATCACAGTTCTAAACACCCCGCTTGTTGCCAGTGCTGGCAATGTACAGCACCTCATCCAGGCTACTC

TCCCAGGTCATGCTGTGGGACAGCCTGAGGGCACAGCAGGGGGGCTGTTGGTCACTCAACCACTGATGGCCAATGGGTTACAAGCATCAAGCTCATCTCT

CCCTCTGACAACTGCATCTGTTCCCAAGCCAACTGTGGCACCCATTAACACTGTGTGTTCAAATTCGGCATCAGCTGTGAAAGTTGTCAATGCAGCCCAG

TCACTCCTCACAGCATGCCCCAGCATAACTTCCCAAGCTTTCCTTGATGCAAACATCTACAAAAATAAGAAGTCTCATGAACAGCTCTCGGCTCTGAAAG

GAAGCTTCTGTCGGAACCAGTTTCCTGGGCAGAGTGAAGTAGAGCATCTGACCAAAGTGACAGGCCTCAGTACCAGAGAGGTGCGGAAGTGGTTCAGTGA

CCGGAGATATCACTGCCGGAATCTGAAGGGCTCCAGGGCCATGATGCCCGGAGAGCATGGCTCTGTTCTCATTGACTCTGTGCCAGAGGTGCCCTTTCCC

CTGGCATCTAAAGTTCCAGAGGTGACCTGTATCCCAACAGCAACCTCACTAGTAAGCCACCCTGCCACCAAACGACAATCTTGGCACCAGACCCCAGACT

TCACACCAACCAAATACAAAGAAAGAGCCCCAGAGCAGCTGCGAGTCCTAGAGAACAGCTTTGCACAAAACCCACTTCCCCCCGAGGAGGAGCTGGACCG

CCTAAGAAGTGAAACGAAAATGACTCGAAGGGAAATTGATGGCTGGTTCTCAGAGAGGCGGAAAAAGGTGAATACTGAGGAGACAAAGAAAGCTGATGGG

CACATGCCTAAGGAGGAGGAGGAGGGTGCTGAGCAGGAGGGTAGAGATGAAGAGTTGGCCAATGAGCTGAGGGTCCCTGGTGAAAATGGCTCTCCTGAAA

TGTTTCTTAGCCATGCCTTGGCAGAACGGAAGGTCAGCCCCATCAAAATCAACCTCAAGAACCTGCGGGTCACTGAAGCCAGTGGCAAGAGTGAGTTTCC

AGGGATGGGTGTCTGTGAGCCTGAGGAAGATGGTTTGAACAAGTTGGTAGAACAGCCACCAAGCAAAGTAAGCTACAAAAAGACCGCACAGCAGCGTCAT

TTGCTTCGGCAGCTCTTTGTCCAAACACAGTGGCCAAGCAACCAGGACTATGACTCCATTATGGCCCAAACAGGGCTGCCCCGGCCAGAGGTGGTACGCT

GGTTTGGAGATAGCAGGTATGCCCTTAAGAATGGCCAGCTCAAGTGGTACGAAGACTATAAGAGGGGAAACTTCCCACCAGGTTTGCTGGTCATAGCCCC

TGGCAACCGAGAGCTGCTGCAAGATTATTACATGACACACAAGATGTTGTGTGAGGAAGATCTGCAGACCCTCTGTGATAAGACCCAGATGAGTGCCCAG

CAGGTCAAGCAGTGGTTTGCTGAGAAGATGGGTGAAGAGACCCGGGCTGTGGCAGATATAAGCAGTGAGGATCAGGGCCCTAGAAATGGAGAGCCTGTGG

CAGTTCACAAGGTGCTGGGTGATGCCTATTCGGAGCTGTCTGAGAACAGCGAATCATGGGAGCCAAGTGCTCCTGAGGCCAGCTCAGAGCCTTTTGACAC

TTCAAGTCCCCAGTCTGGACGTCAACTCG - UNI35435 - AAGCAGACTGAATTTGATCTTGATTACTGTGAAGGACCGGCCAGTCTGGGATGCTGT

ATGCCATGTGGAAGGGCCAAAACTGCCACATATCATCTTGATGGCCAGCTGCCAGGCACCAGGAGAGCCTCTGGAGCCTCGCTGAACCCAGAACCTGCCA

CCGCCCCAACCACCTTCCGCCTGACATTTCTGAGCAAATAGCAATGGTTTCTCATCAGCCCATCTTCCCACAGAGCAGGACCTTTCCATGGCCTCCCAGG

GACAATTCAGATTGCATATACCTAGACCCAGAATCAAGTTGTTAGCATATACAGCTGCCTATATTCATTTAATAAAGCATACTACTACAGACATTTTCAA

TACATAGGAACTCGGGTTACCAAAACAGTACAGCTCTGACAATGCCATGTCTGTTTTCTGGGAAGCTGAGACCACAGGGACCCTCATCCTCTGCAACAGT

GGGAGTCCCAGGCATGCTCAGAACTGCACCAGGCCTGGCCCTACTTGTCTTCTCAAGGGAACAGATTGTTGGAAGAGATCTCTGCATCACTGAGTGGAGG

CAAGCCACATTTTGTGCCAGACTTGTCTTGTGTTCTGATTGACAAAGAGCCCACTGTTACCTTCAGTTCTGAACACAACCAAGCTATGACATTACCATTG

GATGCTAACCATTCTCTTTAGTTAACTGTAATTCTGGTTTTTTTTTGTTTGTTTGTTTGTTTTTGAGTTTGAATCATGGACCAACTTCTCCATTATCAGA

TCAACTAAAGAAACCATTGTTGTAAAGCCCAATCTACTGACCTGTAGCTCCCTTCAGCCCTTCAATCCAGACTCCTTTAGAACAAAAGGAAAGTGATCAA

AGTAGAGCCAATTGCTGTGGCTTTGGTCACCAAAGTGCTCAATGCCTCCTGCAGGTCAGAAGGAAATACATGGTGGCTGGAGGAAGAATGAGGCTGAAGG

GCTTGGGAGATTTGAAGTGACTAGAGCTACACTGTTCTTGAACACAAAGACCTGCAGGTCAGAGTTCCTGGCAAAATGCCTGTCACACACCAAGGGCCCT

GGCCAGCTACTGGTTTCATGATCCAGAGGTGCTGGGCATCACTGGACAGATTCCTGTGAGGGTGTTTTTAAAGTTCCACATTTATATTCCCAACCTGAGA

AACAAGTACTCTATCTACTTTT
Translation
 - UNI35435 -  - UNI35435 - MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEAPDASSEAAPNPSSTDGSALANGHRSTL

DGYVYCCKECEFRSQDVTHFIGHMNSEHTDFNKDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSVLAGESTTEG

TEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVKEGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQ

QPPVHAQHHTHQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQGISWSPEEIEDARKKMF

NTVIQSVPQPTITVLNTPLVASAGNVQHLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVCSNSASAVKVVNAAQ

SLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFP

LASKVPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEEELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADG

HMPKEEEEGAEQEGRDEELANELRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNKLVEQPPSKVSYKKTAQQRH

LLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSAQ

QVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLE - UNI35435 - EAD
Transcript ENSMUST00000103112
Sequence
GAATTGTGTTACCCATGGAAAGCCACAAACAGGCTGGATGAAAGATGAGTTTCTTCCTTTTCTGTCCTTGTCTCCTGCCAACTAGCTCATTGTGGTGAGG

GAAAGAGAGGAGATGAACAGAGATGGTGCTGTGTCAGTTAGTGCACAATCCAACATTTTGCAAG - UNI35435 - GGCTGAATTGCAGCTACAGAGG

CAGCAAACGACTCCTTAAAGATGCCACAGGACTGCAGAAAGTGAAGGGGACCTTGGAGAAGATGATGAAGGAAAAAGAATGTTTCTCCCAAGGACAAGAA

 - UNI35435 - GCTTAAGGAAAAGTGGCTTTCTGCAAATAACTGACAAAACTGACCTTAGAAGCACTTCCCAGGGCCTCATGGAGTAGCTGGAATTT

GTACTACAAGGCTTTCTTGCCTACTGGTTACCTGAAGTGGTTGTCGCCATGGCCAGCAAAAGGAAGTCCACCACCCCATGCATGATCCCCGTTAAGACCG

TGGTGCTGCCGGGTGCCAGCACAGAGCCTCAGCCTGTGGAGTCTCTGCCTGAAGGTCCCCAGCAGGATCTTCCCTCAGAGGCACCTGATGCGAGCAGCGA

GGCAGCCCCAAACCCCAGCAGCACTGATGGCTCTGCCCTGGCAAATGGGCACCGGAGCACTTTGGATGGCTATGTATATTGCTGTAAAGAGTGTGAGTTC

AGGTCCCAGGATGTGACCCACTTTATAGGACATATGAACTCAGAGCACACAGACTTTAATAAAGACCCAACTTTTGTATGTACAGGGTGCAGTTTCCTGG

CAAAAAACCCTGAAGGACTTTCCCTGCATAATGCCAAGTGTCACTCAGGGGAAGCCAGCTTTTTGTGGAATGTGACCAAGCCAGACAATCATGTAGTAGT

GGAGCAGAGTGTCCCTGACAGTGCTAGCTCATCTGTCCTAGCAGGTGAGTCTACTACGGAAGGGACTGAAATCATCATTACCAAGACTCCAATCATGAAG

ATAATGAAAGGCAAAGCTGAAGCCAAAAAAATCCATATGCTTAAAGAGAACGCTCCTAATCAGCCTGGGAGTGAGGCCTTGCCTAAGCCATTGGCAGGGG

AGAGAGAGGTTAAAGAGGGGGACCACACTTTCATCAATGGGGCAGCTCCAGGCAGTCAGGCATCTGCTAAGTCCACAAAACCCCCTCCTGCTGCCAATGG

GCCCCTGATAGGAACAGTGCCTGTCTTGCCAGCTGGTATAGCACAGTTCCTCTCCCTCCAGCAGCAGCCCCCAGTACATGCCCAACACCACACCCACCAA

CCCCTGCCTACATCCAAGACCCTTCCGAAAGTCATGATCCCCTTGAGCAGCATCCCAACATATAATGCAGCTATGGACTCCAACAGCTTTCTGAAGAACT

CCTTCCACAAATTCCCCTACCCAACCAAAGCTGAGCTCTGCTATTTGACTGTGGTGACCAAGTATCCAGAAGAACAGCTTAAAATCTGGTTCACAGCCCA

GAGGCTGAAGCAAGGAATCAGCTGGTCTCCTGAGGAGATTGAAGATGCCAGGAAAAAGATGTTCAATACAGTCATCCAGTCTGTGCCTCAGCCCACAATC

ACAGTTCTAAACACCCCGCTTGTTGCCAGTGCTGGCAATGTACAGCACCTCATCCAGGCTACTCTCCCAGGTCATGCTGTGGGACAGCCTGAGGGCACAG

CAGGGGGGCTGTTGGTCACTCAACCACTGATGGCCAATGGGTTACAAGCATCAAGCTCATCTCTCCCTCTGACAACTGCATCTGTTCCCAAGCCAACTGT

GGCACCCATTAACACTGTGTGTTCAAATTCGGCATCAGCTGTGAAAGTTGTCAATGCAGCCCAGTCACTCCTCACAGCATGCCCCAGCATAACTTCCCAA

GCTTTCCTTGATGCAAACATCTACAAAAATAAGAAGTCTCATGAACAGCTCTCGGCTCTGAAAGGAAGCTTCTGTCGGAACCAGTTTCCTGGGCAGAGTG

AAGTAGAGCATCTGACCAAAGTGACAGGCCTCAGTACCAGAGAGGTGCGGAAGTGGTTCAGTGACCGGAGATATCACTGCCGGAATCTGAAGGGCTCCAG

GGCCATGATGCCCGGAGAGCATGGCTCTGTTCTCATTGACTCTGTGCCAGAGGTGCCCTTTCCCCTGGCATCTAAAGTTCCAGAGGTGACCTGTATCCCA

ACAGCAACCTCACTAGTAAGCCACCCTGCCACCAAACGACAATCTTGGCACCAGACCCCAGACTTCACACCAACCAAATACAAAGAAAGAGCCCCAGAGC

AGCTGCGAGTCCTAGAGAACAGCTTTGCACAAAACCCACTTCCCCCCGAGGAGGAGCTGGACCGCCTAAGAAGTGAAACGAAAATGACTCGAAGGGAAAT

TGATGGCTGGTTCTCAGAGAGGCGGAAAAAGGTGAATACTGAGGAGACAAAGAAAGCTGATGGGCACATGCCTAAGGAGGAGGAGGAGGGTGCTGAGCAG

GAGGGTAGAGATGAAGAGTTGGCCAATGAGCTGAGGGTCCCTGGTGAAAATGGCTCTCCTGAAATGTTTCTTAGCCATGCCTTGGCAGAACGGAAGGTCA

GCCCCATCAAAATCAACCTCAAGAACCTGCGGGTCACTGAAGCCAGTGGCAAGAGTGAGTTTCCAGGGATGGGTGTCTGTGAGCCTGAGGAAGATGGTTT

GAACAAGTTGGTAGAACAGCCACCAAGCAAAGTAAGCTACAAAAAGACCGCACAGCAGCGTCATTTGCTTCGGCAGCTCTTTGTCCAAACACAGTGGCCA

AGCAACCAGGACTATGACTCCATTATGGCCCAAACAGGGCTGCCCCGGCCAGAGGTGGTACGCTGGTTTGGAGATAGCAGGTATGCCCTTAAGAATGGCC

AGCTCAAGTGGTACGAAGACTATAAGAGGGGAAACTTCCCACCAGGTTTGCTGGTCATAGCCCCTGGCAACCGAGAGCTGCTGCAAGATTATTACATGAC

ACACAAGATGTTGTGTGAGGAAGATCTGCAGACCCTCTGTGATAAGACCCAGATGAGTGCCCAGCAGGTCAAGCAGTGGTTTGCTGAGAAGATGGGTGAA

GAGACCCGGGCTGTGGCAGATATAAGCAGTGAGGATCAGGGCCCTAGAAATGGAGAGCCTGTGGCAGTTCACAAGGTGCTGGGTGATGCCTATTCGGAGC

TGTCTGAGAACAGCGAATCATGGGAGCCAAGTGCTCCTGAGGCCAGCTCAGAGCCTTTTGACACTTCAAGTCCCCAGTCTGGACGTCAACTCG - UNI3

5435 - AAGCAGACTGAATTTGATCTTGATTACTGTGAAGGACCGGCCAGTCTGGGATGCTGTATGCCATGTGGAAGGGCCAAAACTGCCACATATCAT

CTTGATGGCCAGCTGCCAGGCACCAGGAGAGCCTCTGGAGCCTCGCTGAACCCAGAACCTGCCACCGCCCCAACCACCTTCCGCCTGACATTTCTGAGCA

AATAGCAATGGTTTCTCATCAGCCCATCTTCCCACAGAGCAGGACCTTTCCATGGCCTCCCAGGGACAATTCAGATTGCATATACCTAGACCCAGAATCA

AGTTGTTAGCATATACAGCTGCCTATATTCATTTAATAAAGCATACTACTACAGACATTTTCAATACATAGGAACTCGGGTTACCAAAACAGTACAGCTC

TGACAATGCCATGTCTGTTTTCTGGGAAGCTGAGACCACAGGGACCCTCATCCTCTGCAACAGTGGGAGTCCCAGGCATGCTCAGAACTGCACCAGGCCT

GGCCCTACTTGTCTTCTCAAGGGAACAGATTGTTGGAAGAGATCTCTGCATCACTGAGTGGAGGCAAGCCACATTTTGTGCCAGACTTGTCTTGTGTTCT

GATTGACAAAGAGCCCACTGTTACCTTCAGTTCTGAACACAACCAAGCTATGACATTACCATTGGATGCTAACCATTCTCTTTAGTTAACTGTAATTCTG

GTTTTTTTTTGTTTGTTTGTTTGTTTTTGAGTTTGAATCATGGACCAACTTCTCCATTATCAGATCAACTAAAGAAACCATTGTTGTAAAGCCCAATCTA

CTGACCTGTAGCTCCCTTCAGCCCTTCAATCCAGACTCCTTTAGAACAAAAGGAAAGTGATCAAAGTAGAGCCAATTGCTGTGGCTTTGGTCACCAAAGT

GCTCAATGCCTCCTGCAGGTCAGAAGGAAATACATGGTGGCTGGAGGAAGAATGAGGCTGAAGGGCTTGGGAGATTTGAAGTGACTAGAGCTACACTGTT

CTTGAACACAAAGACCTGCAGGTCAGAGTTCCTGGCAAAATGCCTGTCACACACCAAGGGCCCTGGCCAGCTACTGGTTTCATGATCCAGAGGTGCTGGG

CATCACTGGACAGATTCCTGTGAGGGTGTTTTTAAAGTTCCACATTTATATTCCCAACCTGAGAAACAAGTACTCTATCTACTTTTGCCTAAGCCTCATG

TCTTTTTAATTAAAATCACAAGAAATGGTGCCTTTGAAACAATGGAAAACTTGCTTAGGGAACTGTACTAAACATTAAAGCCCCAGTCTCACCTAGGCTG

GCTTCTCTGAGAGCAGTAGACAAAGCAGGGTAGGGGAGGGAAAGATGACAAACAGGATGTGTCATCATAGCCCCACTTACCTCTTGGAGATTCCATCAGG

AGACCCACAGGCAGGGCAAGAGCTTTGAAAACCAAGAAGCAGTGGTCAACTTCCAGGTGTTCTCCTCCCTCCCTTCCCAGGGGAGGGGAATAGTCTGAGG

ATGAACATGGCGGCCTTCAGCCTTTTAGGAAAGAGGGCTTTTTTTTGTAATCCAGGGCCCTGGAACCATTATAAGTTGTTTCTCCTGCCCTTCCTGTTCC

CATAGGGATGGCCTCACGTTTGATTGGAATTTATTATTTTGTTTTATTTTTGGGGTTTTTTTTTTTTTTTTTTTTTGACTACTTGGCAAGTTTTGTTGCC

TATTTTTGTATCCTTTCTGTTTGGGGAGGGAAGCTATTTGGCCCCAAACCTTGAGGAATTGGAAAGAATAAATGGTGAGTGATTGTTTTTCTTCAGAGAA

CAGAAGCCTGAACGTTCTCCAGAACATGTTTGTATATGTGCAGATTTACATATCCATATATACAGGACACATACTTATTTGATACTTTATTCATAAATCG

TACAACTGATGTGCATTTGAGCTTCATGTGGATGCCTAGGGGGAAGTAGTCTGTGTGTGAAGAGAGAACAGTATACTGGGCAGCTGGAGCAGCAGGGGAA

GCCATCTCCTGTCTAAGAAGCATGTGTGTCTCACCTGAGCCCAGACGCCTGCTGGGCTTCTCCTCCAGAGCCCTGCTGCACTAGCTGAACAGTAGACTAT

AAAAATGTCTGAACAATGTACATGGAACAGAAACATTACGTTACTTGGTGGACATTATGCAGGACACAGAGAGCAGCCTGGTCTCGGGCACTAGGTAGTC

TTCTGGATGGGAAGTTGCAGTAACACTGGCCCCAGCACACCTTTCTCAGAGCTGGTAATGGCAAGATTGTTCAGGTAAGAAACAAGTTGCTTCCTTTGCC

CTTGGATAGGGGAGGGAAGTTGTGGCTTGGACCTTGTTTGATAGATAATGGTGAGGGAGGTGGTCATAGCGTAGGCACTCCAGGGAAGGGCTTTGGGTAC

CAAGCATGGGTGCACTGACAGAGGAGTTGGGGTGTAGGTTGGCAGATACCAGGTCTATGGTTACTATGTGACATCACAGTGGCCTTGTACAGTTGGAGGC

TCAATAGAAGGCTGGCCGTGGCTGCTGAGGTGGGGTGGAATGTGCTTCTCCTAACAAGGTGTGCTTTGTGACATGGTGAGTCTTGCCCTATCTTCTGCAC

TCACTTGGACTTACCAGAGGCAGTACATTCTAAGTGTCTTTTGTGCTGGTCTTGTATATTGATTTTTTTCTACTCATATATGTCAGTTCAGTTACAGATC

AGAACCAACTCTAACAGAAACCTAAACTTATACATAAGCTTTGCATATTATTTGTAATTTTTTGATCAGATTTTTTTTTCTTTTGGTAGTTGGGTGTGTT

AGTGTTGGGAGTCCTTTCCCTAGATGACTTTGAGGTCTACTAGTGACGGTCCTTGCACTTTTCTCTTGGCTGGGTGTCAGCAGCTGCCAGTGAACAAAAT

ACCTTAGCACGAGGGCACCCTCCCCTCTGGAAGCACAAGGAGAGTTGGGTGGGACCTGGTAGGTAGCTACCTGTATCCTAAGTCTCTCTCCAGCTGCCCT

TGGGTATGTGCTACCAGGAAGCTCAGCTGCATTCTCCAGACCCAGATGGCTCTCAGAGATTTTACTTGTTCTGACAGTAGCTATGTCATACCTGTGTCCC

TTCCTCCCTGCTGGCCCTAGGACATCTGTCACACAGCTGCCTCCTGTGGAGGGTAGGGATGAGGGAGCAACCTTGCTGGTTGGAGACTCGTTTTGTCCTC

TAGGTGAGTGTTGAGCTGTCCCTATCTTGAGCCATTACCTTTTGTCTTCCTAGTTTCTACGTGGACCAAAACCCTCAGAGTGGAGCAGCTCAGTCAGTGC

CACTGTCACAGCCCAAAGGCACTTTCTGGGAAGCCGGCCAAGGAAATCCTAAAACAAAACTTAGAATTTGTGTTTTTACTAAAGCCACTTTGCAGATGAA

GTTCTATCATATTCATTTGTAAGGCTCTGTTTTCTGCAGTAGTCTTCTAGATACATAAAGGTCTTTGGTCAGCTCATCCTATCCAAATTTTGGCATGCTG

CCTGGTTTTTCTTATACTAGACTGAAGCCTTTTCGCTAACATCCCTGATTTAGCCTCATCTTCTCCTATAAGAGCACACCGTTCACCACCAACCTGCCCA

AACCTTTATGAGCTGATTTCCATGTGTTATAGCACTGGAGCCCACAGGCCTTTCTAAGTACAGGTCTCCCAAGACTTGAGCCTGAATTATCCACATTGCA

GTTTCTTCTGCCTTGGTTCAGTGGAGTAGGTAGGTTGCTGCGCTCTATCCTCTAGGGCTAATAAGGCTGTTGAGGGTCTTCAGTGGAATGGCTGGGTTTA

GTTTTGACTAATGACAGAACTGACGATCGTACTATCTGCTGTTTACATCGCTTACTAGCTAGAAATCCAAAAGGAATGGGGTTCTCAGAGTCTGTTTCTG

CCAAAATCTGTGATCTCTTGTGCCTGGCCACTAGGGATGGCTGGCATCTAGGTAGTGGCAAGCCCAAATGTACTTTCCAGAATTTGTACTTTGTTGTGGT

GTGAAAGCAGCTCAGAGAGTGAATGGCCCTAGGACTGAGCGCCTGCTTTGTTCTGAGTGCTTATTAACCCAGCAGGCCTATGAACTTGGTCCCCCAGACT

GGAAAGCCAAAACAGGGTTTTCTAGTTCTGAGTCTAGCAGGAACACCTCTTCCCAACTCCCTAAATTCTGGAGCAGGGATGTAAATCCAGAGAGAACACT

TGGGCTGCCTACTACAGACTAAGGCAGATTCTGGTTGCTACAAGGAAGAGGTAGGCACCCGCTTCCTTGGTTCTTCAGGCTCTTATGGATGTGGGACTGA

ATGGATTCAGTGAAGTTACCACTCTGTTGTCTCTTCCCTCCTTGAAACATACCTTGCAGCTACTCTGGCAGGAACCAGGCAGAAGAGAGGGAGGACAGCT

ATTTGGCAGGGACTGTGCTACATGGTGTCTTCCTGCTGTTGACAAGGGTGGGCAAATGGCAAGTTAGAACACCTGGGAGGGGCTTGCACATTTACCTGCT

ATCAGTGCCACTTTTGTCAAGAGACTGGCATACTGTGCCCACAGTGGGCACCTGTATGTTAATAGCTTTTCTTGATCTATGCCTTTTGACACATGTTCCC

TTCCATGGAAAGTGGGTGATTCAGTTTATTCAGAACTTGAGTTGAAGGTAAACTGCCTAGGATAAAGCCTGCTCAATCACTGAATATAAAAAGGGCTGCC

AGTGCTCTGTTCTCCCCCAAACAAGCACCAGAAGAGACATGTCCAGTGGGCGGAAGTCTATTACGTGGTCCTGCTAACCTGCAGTTAGTGCTTCGGAAAG

ATCTTGCCCCTAGCTCCTGTCCACACATCTTGGTCTTGTTCTTGTAGCCCCATATGAGAAGGCTGGCTGCAGTGAGAGCGAACTCCCATTCCTTAGCAGG

ATTCCAGCACAAGTTAGGTTGCTCTGTGAAATGGGTGGGCCGAGGGCAGGAGTGGTCACTCAGGGCACTGGTCTCTCTCCCATGCTTCTGAGTAGCTGGC

TTTGTTCAGCTTTGCCAGGAAGGTCAGACTGTGTCATAATTGTTATTAAACACAGAAAATGAGCCAACTTTTTTCTGGCCCTTGCTGACTATTGTTCTTT

GAGTTGTCCTGACATAGCCCTTGGGGAAATTGGGGAGGCAGCCAAAGACCTGCAGTGTCCTTGCTGACAATGTCTTGGATCCTGGTCCCCAGCACCTGCT

TTGTGTCCTGACCTCAGTGTGGACGGCTTTGTTCTCAGGGGGCCCGACTGCTGAGAAGTACGGCTGGGGGTGATTTGAACAGTCTGCCTTTGGTGTGCTT

CCTGTCTCCCAGGAACAGCTGAAGCGACTATCCTGGTGCTAAGTGAGGGTCACCTGCTACTGCGGCCAACTATGAAAGCGAACTAAGAAATAGCATATTC

TGTCACATAGACCTATGTGTGGCCCTAGCTGGCCTCCTACCTGCCTGGTCGACTCACTGTGTAGACCAGGCTGGCCTCAGACTTGGGTGCTCTTCCTGCC

TCTACCTCCCAAGCACTGAGTTACAGGCATGGGCCACAACTGGCTGGAGTGTAGAAATCCTTCACCCTGGGAAACATTGGAATAGAAAGACAGCCTTTGC

TTTTGGTGTGGGCTGTGTGTGGTGGGAGGTGCGAGGATGACCTCTTCTGTCTGAGTCTCGGGCCTCTTAAGGTCCCCCATGGGGATGCTGCTATTTCCAA

GATGCAAATTGCACATTTCCTAGATTTTGTATCTGCAAATATGGATAAGGGATGGGATGAGGGACAAAACTGCTTGTGTAGTTTGAATGGGCCTCGGCGG

TACTTCCAATCTTTTAACTGTTCCTAAATAAAAATGTACAGACACTTCTTA
Translation
 - UNI35435 -  - UNI35435 - MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEAPDASSEAAPNPSSTDGSALANGHRSTL

DGYVYCCKECEFRSQDVTHFIGHMNSEHTDFNKDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSVLAGESTTEG

TEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVKEGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQ

QPPVHAQHHTHQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQGISWSPEEIEDARKKMF

NTVIQSVPQPTITVLNTPLVASAGNVQHLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVCSNSASAVKVVNAAQ

SLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFP

LASKVPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEEELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADG

HMPKEEEEGAEQEGRDEELANELRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNKLVEQPPSKVSYKKTAQQRH

LLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSAQ

QVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLE - UNI35435 - EAD
Transcript ENSMUST00000103111
Sequence
TCTCTGTGGGTGGTTAATCTTAAAGACAGATGGTCCTAAGTGGGTTTCTTCCTATAATAACAATTAAG - UNI35435 - GGCTGAATTGCAGCTACA

GAGGCAGCAAACGACTCCTTAAAGATGCCACAGGACTGCAGAAAGTGAAGGGGACCTTGGAGAAGATGATGAAGGAAAAAGAATGTTTCTCCCAAGGACA

AGAA - UNI35435 - GCTTAAGGAAAAGTGGCTTTCTGCAAATAACTGACAAAACTGACCTTAGAAGCACTTCCCAGGGCCTCATGGAGTAGCTGGA

ATTTGTACTACAAGGCTTTCTTGCCTACTGGTTACCTGAAGTGGTTGTCGCCATGGCCAGCAAAAGGAAGTCCACCACCCCATGCATGATCCCCGTTAAG

ACCGTGGTGCTGCCGGGTGCCAGCACAGAGCCTCAGCCTGTGGAGTCTCTGCCTGAAGGTCCCCAGCAGGATCTTCCCTCAGAGGCACCTGATGCGAGCA

GCGAGGCAGCCCCAAACCCCAGCAGCACTGATGGCTCTGCCCTGGCAAATGGGCACCGGAGCACTTTGGATGGCTATGTATATTGCTGTAAAGAGTGTGA

GTTCAGGTCCCAGGATGTGACCCACTTTATAGGACATATGAACTCAGAGCACACAGACTTTAATAAAGACCCAACTTTTGTATGTACAGGGTGCAGTTTC

CTGGCAAAAAACCCTGAAGGACTTTCCCTGCATAATGCCAAGTGTCACTCAGGGGAAGCCAGCTTTTTGTGGAATGTGACCAAGCCAGACAATCATGTAG

TAGTGGAGCAGAGTGTCCCTGACAGTGCTAGCTCATCTGTCCTAGCAGGTGAGTCTACTACGGAAGGGACTGAAATCATCATTACCAAGACTCCAATCAT

GAAGATAATGAAAGGCAAAGCTGAAGCCAAAAAAATCCATATGCTTAAAGAGAACGCTCCTAATCAGCCTGGGAGTGAGGCCTTGCCTAAGCCATTGGCA

GGGGAGAGAGAGGTTAAAGAGGGGGACCACACTTTCATCAATGGGGCAGCTCCAGGCAGTCAGGCATCTGCTAAGTCCACAAAACCCCCTCCTGCTGCCA

ATGGGCCCCTGATAGGAACAGTGCCTGTCTTGCCAGCTGGTATAGCACAGTTCCTCTCCCTCCAGCAGCAGCCCCCAGTACATGCCCAACACCACACCCA

CCAACCCCTGCCTACATCCAAGACCCTTCCGAAAGTCATGATCCCCTTGAGCAGCATCCCAACATATAATGCAGCTATGGACTCCAACAGCTTTCTGAAG

AACTCCTTCCACAAATTCCCCTACCCAACCAAAGCTGAGCTCTGCTATTTGACTGTGGTGACCAAGTATCCAGAAGAACAGCTTAAAATCTGGTTCACAG

CCCAGAGGCTGAAGCAAGGAATCAGCTGGTCTCCTGAGGAGATTGAAGATGCCAGGAAAAAGATGTTCAATACAGTCATCCAGTCTGTGCCTCAGCCCAC

AATCACAGTTCTAAACACCCCGCTTGTTGCCAGTGCTGGCAATGTACAGCACCTCATCCAGGCTACTCTCCCAGGTCATGCTGTGGGACAGCCTGAGGGC

ACAGCAGGGGGGCTGTTGGTCACTCAACCACTGATGGCCAATGGGTTACAAGCATCAAGCTCATCTCTCCCTCTGACAACTGCATCTGTTCCCAAGCCAA

CTGTGGCACCCATTAACACTGTGTGTTCAAATTCGGCATCAGCTGTGAAAGTTGTCAATGCAGCCCAGTCACTCCTCACAGCATGCCCCAGCATAACTTC

CCAAGCTTTCCTTGATGCAAACATCTACAAAAATAAGAAGTCTCATGAACAGCTCTCGGCTCTGAAAGGAAGCTTCTGTCGGAACCAGTTTCCTGGGCAG

AGTGAAGTAGAGCATCTGACCAAAGTGACAGGCCTCAGTACCAGAGAGGTGCGGAAGTGGTTCAGTGACCGGAGATATCACTGCCGGAATCTGAAGGGCT

CCAGGGCCATGATGCCCGGAGAGCATGGCTCTGTTCTCATTGACTCTGTGCCAGAGGTGCCCTTTCCCCTGGCATCTAAAGTTCCAGAGGTGACCTGTAT

CCCAACAGCAACCTCACTAGTAAGCCACCCTGCCACCAAACGACAATCTTGGCACCAGACCCCAGACTTCACACCAACCAAATACAAAGAAAGAGCCCCA

GAGCAGCTGCGAGTCCTAGAGAACAGCTTTGCACAAAACCCACTTCCCCCCGAGGAGGAGCTGGACCGCCTAAGAAGTGAAACGAAAATGACTCGAAGGG

AAATTGATGGCTGGTTCTCAGAGAGGCGGAAAAAGGTGAATACTGAGGAGACAAAGAAAGCTGATGGGCACATGCCTAAGGAGGAGGAGGAGGGTGCTGA

GCAGGAGGGTAGAGATGAAGAGTTGGCCAATGAGCTGAGGGTCCCTGGTGAAAATGGCTCTCCTGAAATGTTTCTTAGCCATGCCTTGGCAGAACGGAAG

GTCAGCCCCATCAAAATCAACCTCAAGAACCTGCGGGTCACTGAAGCCAGTGGCAAGAGTGAGTTTCCAGGGATGGGTGTCTGTGAGCCTGAGGAAGATG

GTTTGAACAAGTTGGTAGAACAGCCACCAAGCAAAGTAAGCTACAAAAAGACCGCACAGCAGCGTCATTTGCTTCGGCAGCTCTTTGTCCAAACACAGTG

GCCAAGCAACCAGGACTATGACTCCATTATGGCCCAAACAGGGCTGCCCCGGCCAGAGGTGGTACGCTGGTTTGGAGATAGCAGGTATGCCCTTAAGAAT

GGCCAGCTCAAGTGGTACGAAGACTATAAGAGGGGAAACTTCCCACCAGGTTTGCTGGTCATAGCCCCTGGCAACCGAGAGCTGCTGCAAGATTATTACA

TGACACACAAGATGTTGTGTGAGGAAGATCTGCAGACCCTCTGTGATAAGACCCAGATGAGTGCCCAGCAGGTCAAGCAGTGGTTTGCTGAGAAGATGGG

TGAAGAGACCCGGGCTGTGGCAGATATAAGCAGTGAGGATCAGGGCCCTAGAAATGGAGAGCCTGTGGCAGTTCACAAGGTGCTGGGTGATGCCTATTCG

GAGCTGTCTGAGAACAGCGAATCATGGGAGCCAAGTGCTCCTGAGGCCAGCTCAGAGCCTTTTGACACTTCAAGTCCCCAGTCTGGACGTCAACTCG - 

UNI35435 - AAGCAGACTGAATTTGATCTTGATTACTGTGAAGGACCGGCCAGTCTGGGATGCTGTATGCCATGTGGAAGGGCCAAAACTGCCACATA

TCATCTTGATGGCCAGCTGCCAGGCACCAGGAGAGCCTCTGGAGCCTCGCTGAACCCAGAACCTGCCACCGCCCCAACCACCTTCCGCCTGACATTTCTG

AGCAAATAGCAATGGTTTCTCATCAGCCCATCTTCCCACAGAGCAGGACCTTTCCATGGCCTCCCAGGGACAATTCAGATTGCATATACCTAGACCCAGA

ATCAAGTTGTTAGCATATACAGCTGCCTATATTCATTTAATAAAGCATACTACTACAGACATTTTCAATACATAGGAACTCGGGTTACCAAAACAGTACA

GCTCTGACAATGCCATGTCTGTTTTCTGGGAAGCTGAGACCACAGGGACCCTCATCCTCTGCAACAGTGGGAGTCCCAGGCATGCTCAGAACTGCACCAG

GCCTGGCCCTACTTGTCTTCTCAAGGGAACAGATTGTTGGAAGAGATCTCTGCATCACTGAGTGGAGGCAAGCCACATTTTGTGCCAGACTTGTCTTGTG

TTCTGATTGACAAAGAGCCCACTGTTACCTTCAGTTCTGAACACAACCAAGCTATGACATTACCATTGGATGCTAACCATTCTCTTTAGTTAACTGTAAT

TCTGGTTTTTTTTTGTTTGTTTGTTTGTTTTTGAGTTTGAATCATGGACCAACTTCTCCATTATCAGATCAACTAAAGAAACCATTGTTGTAAAGCCCAA

TCTACTGACCTGTAGCTCCCTTCAGCCCTTCAATCCAGACTCCTTTAGAACAAAAGGAAAGTGATCAAAGTAGAGCCAATTGCTGTGGCTTTGGTCACCA

AAGTGCTCAATGCCTCCTGCAGGTCAGAAGGAAATACATGGTGGCTGGAGGAAGAATGAGGCTGAAGGGCTTGGGAGATTTGAAGTGACTAGAGCTACAC

TGTTCTTGAACACAAAGACCTGCAGGTCAGAGTTCCTGGCAAAATGCCTGTCACACACCAAGGGCCCTGGCCAGCTACTGGTTTCATGATCCAGAGGTGC

TGGGCATCACTGGACAGATTCCTGTGAGGGTGTTTTTAAAGTTCCACATTTATATTCCCAACCTGAGAAACAAGTACTCTATCTACTTTTGCCTAAGCCT

CATGTCTTTTTAATTAAAATCACAAGAAATGGTGCCTTTGAAACAATGGAAAACTTGCTTAGGGAACTGTACTAAACATTAAAGCCCCAGTCTCACCTAG

GCTGGCTTCTCTGAGAGCAGTAGACAAAGCAGGGTAGGGGAGGGAAAGATGACAAACAGGATGTGTCATCATAGCCCCACTTACCTCTTGGAGATTCCAT

CAGGAGACCCACAGGCAGGGCAAGAGCTTTGAAAACCAAGAAGCAGTGGTCAACTTCCAGGTGTTCTCCTCCCTCCCTTCCCAGGGGAGGGGAATAGTCT

GAGGATGAACATGGCGGCCTTCAGCCTTTTAGGAAAGAGGGCTTTTTTTTGTAATCCAGGGCCCTGGAACCATTATAAGTTGTTTCTCCTGCCCTTCCTG

TTCCCATAGGGATGGCCTCACGTTTGATTGGAATTTATTATTTTGTTTTATTTTTGGGGTTTTTTTTTTTTTTTTTTTTTGACTACTTGGCAAGTTTTGT

TGCCTATTTTTGTATCCTTTCTGTTTGGGGAGGGAAGCTATTTGGCCCCAAACCTTGAGGAATTGGAAAGAATAAATGGTGAGTGATTGTTTTTCTTCAG

AGAACAGAAGCCTGAACGTTCTCCAGAACATGTTTGTATATGTGCAGATTTACATATCCATATATACAGGACACATACTTATTTGATACTTTATTCATAA

ATCGTACAACTGATGTGCATTTGAGCTTCATGTGGATGCCTAGGGGGAAGTAGTCTGTGTGTGAAGAGAGAACAGTATACTGGGCAGCTGGAGCAGCAGG

GGAAGCCATCTCCTGTCTAAGAAGCATGTGTGTCTCACCTGAGCCCAGACGCCTGCTGGGCTTCTCCTCCAGAGCCCTGCTGCACTAGCTGAACAGTAGA

CTATAAAAATGTCTGAACAATGTACATGGAACAGAAACATTACGTTACTTGGTGGACATTATGCAGGACACAGAGAGCAGCCTGGTCTCGGGCACTAGGT

AGTCTTCTGGATGGGAAGTTGCAGTAACACTGGCCCCAGCACACCTTTCTCAGAGCTGGTAATGGCAAGATTGTTCAGGTAAGAAACAAGTTGCTTCCTT

TGCCCTTGGATAGGGGAGGGAAGTTGTGGCTTGGACCTTGTTTGATAGATAATGGTGAGGGAGGTGGTCATAGCGTAGGCACTCCAGGGAAGGGCTTTGG

GTACCAAGCATGGGTGCACTGACAGAGGAGTTGGGGTGTAGGTTGGCAGATACCAGGTCTATGGTTACTATGTGACATCACAGTGGCCTTGTACAGTTGG

AGGCTCAATAGAAGGCTGGCCGTGGCTGCTGAGGTGGGGTGGAATGTGCTTCTCCTAACAAGGTGTGCTTTGTGACATGGTGAGTCTTGCCCTATCTTCT

GCACTCACTTGGACTTACCAGAGGCAGTACATTCTAAGTGTCTTTTGTGCTGGTCTTGTATATTGATTTTTTTCTACTCATATATGTCAGTTCAGTTACA

GATCAGAACCAACTCTAACAGAAACCTAAACTTATACATAAGCTTTGCATATTATTTGTAATTTTTTGATCAGATTTTTTTTTCTTTTGGTAGTTGGGTG

TGTTAGTGTTGGGAGTCCTTTCCCTAGATGACTTTGAGGTCTACTAGTGACGGTCCTTGCACTTTTCTCTTGGCTGGGTGTCAGCAGCTGCCAGTGAACA

AAATACCTTAGCACGAGGGCACCCTCCCCTCTGGAAGCACAAGGAGAGTTGGGTGGGACCTGGTAGGTAGCTACCTGTATCCTAAGTCTCTCTCCAGCTG

CCCTTGGGTATGTGCTACCAGGAAGCTCAGCTGCATTCTCCAGACCCAGATGGCTCTCAGAGATTTTACTTGTTCTGACAGTAGCTATGTCATACCTGTG

TCCCTTCCTCCCTGCTGGCCCTAGGACATCTGTCACACAGCTGCCTCCTGTGGAGGGTAGGGATGAGGGAGCAACCTTGCTGGTTGGAGACTCGTTTTGT

CCTCTAGGTGAGTGTTGAGCTGTCCCTATCTTGAGCCATTACCTTTTGTCTTCCTAGTTTCTACGTGGACCAAAACCCTCAGAGTGGAGCAGCTCAGTCA

GTGCCACTGTCACAGCCCAAAGGCACTTTCTGGGAAGCCGGCCAAGGAAATCCTAAAACAAAACTTAGAATTTGTGTTTTTACTAAAGCCACTTTGCAGA

TGAAGTTCTATCATATTCATTTGTAAGGCTCTGTTTTCTGCAGTAGTCTTCTAGATACATAAAGGTCTTTGGTCAGCTCATCCTATCCAAATTTTGGCAT

GCTGCCTGGTTTTTCTTATACTAGACTGAAGCCTTTTCGCTAACATCCCTGATTTAGCCTCATCTTCTCCTATAAGAGCACACCGTTCACCACCAACCTG

CCCAAACCTTTATGAGCTGATTTCCATGTGTTATAGCACTGGAGCCCACAGGCCTTTCTAAGTACAGGTCTCCCAAGACTTGAGCCTGAATTATCCACAT

TGCAGTTTCTTCTGCCTTGGTTCAGTGGAGTAGGTAGGTTGCTGCGCTCTATCCTCTAGGGCTAATAAGGCTGTTGAGGGTCTTCAGTGGAATGGCTGGG

TTTAGTTTTGACTAATGACAGAACTGACGATCGTACTATCTGCTGTTTACATCGCTTACTAGCTAGAAATCCAAAAGGAATGGGGTTCTCAGAGTCTGTT

TCTGCCAAAATCTGTGATCTCTTGTGCCTGGCCACTAGGGATGGCTGGCATCTAGGTAGTGGCAAGCCCAAATGTACTTTCCAGAATTTGTACTTTGTTG

TGGTGTGAAAGCAGCTCAGAGAGTGAATGGCCCTAGGACTGAGCGCCTGCTTTGTTCTGAGTGCTTATTAACCCAGCAGGCCTATGAACTTGGTCCCCCA

GACTGGAAAGCCAAAACAGGGTTTTCTAGTTCTGAGTCTAGCAGGAACACCTCTTCCCAACTCCCTAAATTCTGGAGCAGGGATGTAAATCCAGAGAGAA

CACTTGGGCTGCCTACTACAGACTAAGGCAGATTCTGGTTGCTACAAGGAAGAGGTAGGCACCCGCTTCCTTGGTTCTTCAGGCTCTTATGGATGTGGGA

CTGAATGGATTCAGTGAAGTTACCACTCTGTTGTCTCTTCCCTCCTTGAAACATACCTTGCAGCTACTCTGGCAGGAACCAGGCAGAAGAGAGGGAGGAC

AGCTATTTGGCAGGGACTGTGCTACATGGTGTCTTCCTGCTGTTGACAAGGGTGGGCAAATGGCAAGTTAGAACACCTGGGAGGGGCTTGCACATTTACC

TGCTATCAGTGCCACTTTTGTCAAGAGACTGGCATACTGTGCCCACAGTGGGCACCTGTATGTTAATAGCTTTTCTTGATCTATGCCTTTTGACACATGT

TCCCTTCCATGGAAAGTGGGTGATTCAGTTTATTCAGAACTTGAGTTGAAGGTAAACTGCCTAGGATAAAGCCTGCTCAATCACTGAATATAAAAAGGGC

TGCCAGTGCTCTGTTCTCCCCCAAACAAGCACCAGAAGAGACATGTCCAGTGGGCGGAAGTCTATTACGTGGTCCTGCTAACCTGCAGTTAGTGCTTCGG

AAAGATCTTGCCCCTAGCTCCTGTCCACACATCTTGGTCTTGTTCTTGTAGCCCCATATGAGAAGGCTGGCTGCAGTGAGAGCGAACTCCCATTCCTTAG

CAGGATTCCAGCACAAGTTAGGTTGCTCTGTGAAATGGGTGGGCCGAGGGCAGGAGTGGTCACTCAGGGCACTGGTCTCTCTCCCATGCTTCTGAGTAGC

TGGCTTTGTTCAGCTTTGCCAGGAAGGTCAGACTGTGTCATAATTGTTATTAAACACAGAAAATGAGCCAACTTTTTTCTGGCCCTTGCTGACTATTGTT

CTTTGAGTTGTCCTGACATAGCCCTTGGGGAAATTGGGGAGGCAGCCAAAGACCTGCAGTGTCCTTGCTGACAATGTCTTGGATCCTGGTCCCCAGCACC

TGCTTTGTGTCCTGACCTCAGTGTGGACGGCTTTGTTCTCAGGGGGCCCGACTGCTGAGAAGTACGGCTGGGGGTGATTTGAACAGTCTGCCTTTGGTGT

GCTTCCTGTCTCCCAGGAACAGCTGAAGCGACTATCCTGGTGCTAAGTGAGGGTCACCTGCTACTGCGGCCAACTATGAAAGCGAACTAAGAAATAGCAT

ATTCTGTCACATAGACCTATGTGTGGCCCTAGCTGGCCTCCTACCTGCCTGGTCGACTCACTGTGTAGACCAGGCTGGCCTCAGACTTGGGTGCTCTTCC

TGCCTCTACCTCCCAAGCACTGAGTTACAGGCATGGGCCACAACTGGCTGGAGTGTAGAAATCCTTCACCCTGGGAAACATTGGAATAGAAAGACAGCCT

TTGCTTTTGGTGTGGGCTGTGTGTGGTGGGAGGTGCGAGGATGACCTCTTCTGTCTGAGTCTCGGGCCTCTTAAGGTCCCCCATGGGGATGCTGCTATTT

CCAAGATGCAAATTGCACATTTCCTAGATTTTGTATCTGCAAATATGGATAAGGGATGGGATGAGGGACAAAACTGCTTGTGTAGTTTGAATGGGCCTCG

GCGGTACTTCCAATCTTTTAACTGTTCCTAAATAAAAATGTACAGACACTTCTTA
Translation
 - UNI35435 -  - UNI35435 - MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEAPDASSEAAPNPSSTDGSALANGHRSTL

DGYVYCCKECEFRSQDVTHFIGHMNSEHTDFNKDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSVLAGESTTEG

TEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVKEGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQ

QPPVHAQHHTHQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQGISWSPEEIEDARKKMF

NTVIQSVPQPTITVLNTPLVASAGNVQHLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVCSNSASAVKVVNAAQ

SLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFP

LASKVPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEEELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADG

HMPKEEEEGAEQEGRDEELANELRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNKLVEQPPSKVSYKKTAQQRH

LLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSAQ

QVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLE - UNI35435 - EAD
Transcript ENSMUST00000041220
Sequence
TTCTCTCTGTGGGTGGTTAATCTTAAAGACAGATGGTCCTAAGTGGGTTTCTTCCTATAATAACAATTAAG - UNI35435 - GGCTGAATTGCAGCT

ACAGAGGCAGCAAACGACTCCTTAAAGATGCCACAGGACTGCAGAAAGTGAAGGGGACCTTGGAGAAGATGATGAAGGAAAAAGAATGTTTCTCCCAAGG

ACAAGAA - UNI35435 - GCTTAAGGAAAAGTGGCTTTCTGCAAATAACTGACAAAACTGACCTTAGAAGCACTTCCCAGGGCCTCATGGAGTAGCT

GGAATTTGTACTACAAGGCTTTCTTGCCTACTGGTTACCTGAAGTGGTTGTCGCCATGGCCAGCAAAAGGAAGTCCACCACCCCATGCATGATCCCCGTT

AAGACCGTGGTGCTGCCGGGTGCCAGCACAGAGCCTCAGCCTGTGGAGTCTCTGCCTGAAGGTCCCCAGCAGGATCTTCCCTCAGAGGCACCTGATGCGA

GCAGCGAGGCAGCCCCAAACCCCAGCAGCACTGATGGCTCTGCCCTGGCAAATGGGCACCGGAGCACTTTGGATGGCTATGTATATTGCTGTAAAGAGTG

TGAGTTCAGGTCCCAGGATGTGACCCACTTTATAGGACATATGAACTCAGAGCACACAGACTTTAATAAAGACCCAACTTTTGTATGTACAGGGTGCAGT

TTCCTGGCAAAAAACCCTGAAGGACTTTCCCTGCATAATGCCAAGTGTCACTCAGGGGAAGCCAGCTTTTTGTGGAATGTGACCAAGCCAGACAATCATG

TAGTAGTGGAGCAGAGTGTCCCTGACAGTGCTAGCTCATCTGTCCTAGCAGGTGAGTCTACTACGGAAGGGACTGAAATCATCATTACCAAGACTCCAAT

CATGAAGATAATGAAAGGCAAAGCTGAAGCCAAAAAAATCCATATGCTTAAAGAGAACGCTCCTAATCAGCCTGGGAGTGAGGCCTTGCCTAAGCCATTG

GCAGGGGAGAGAGAGGTTAAAGAGGGGGACCACACTTTCATCAATGGGGCAGCTCCAGGCAGTCAGGCATCTGCTAAGTCCACAAAACCCCCTCCTGCTG

CCAATGGGCCCCTGATAGGAACAGTGCCTGTCTTGCCAGCTGGTATAGCACAGTTCCTCTCCCTCCAGCAGCAGCCCCCAGTACATGCCCAACACCACAC

CCACCAACCCCTGCCTACATCCAAGACCCTTCCGAAAGTCATGATCCCCTTGAGCAGCATCCCAACATATAATGCAGCTATGGACTCCAACAGCTTTCTG

AAGAACTCCTTCCACAAATTCCCCTACCCAACCAAAGCTGAGCTCTGCTATTTGACTGTGGTGACCAAGTATCCAGAAGAACAGCTTAAAATCTGGTTCA

CAGCCCAGAGGCTGAAGCAAGGAATCAGCTGGTCTCCTGAGGAGATTGAAGATGCCAGGAAAAAGATGTTCAATACAGTCATCCAGTCTGTGCCTCAGCC

CACAATCACAGTTCTAAACACCCCGCTTGTTGCCAGTGCTGGCAATGTACAGCACCTCATCCAGGCTACTCTCCCAGGTCATGCTGTGGGACAGCCTGAG

GGCACAGCAGGGGGGCTGTTGGTCACTCAACCACTGATGGCCAATGGGTTACAAGCATCAAGCTCATCTCTCCCTCTGACAACTGCATCTGTTCCCAAGC

CAACTGTGGCACCCATTAACACTGTGTGTTCAAATTCGGCATCAGCTGTGAAAGTTGTCAATGCAGCCCAGTCACTCCTCACAGCATGCCCCAGCATAAC

TTCCCAAGCTTTCCTTGATGCAAACATCTACAAAAATAAGAAGTCTCATGAACAGCTCTCGGCTCTGAAAGGAAGCTTCTGTCGGAACCAGTTTCCTGGG

CAGAGTGAAGTAGAGCATCTGACCAAAGTGACAGGCCTCAGTACCAGAGAGGTGCGGAAGTGGTTCAGTGACCGGAGATATCACTGCCGGAATCTGAAGG

GCTCCAGGGCCATGATGCCCGGAGAGCATGGCTCTGTTCTCATTGACTCTGTGCCAGAGGTGCCCTTTCCCCTGGCATCTAAAGTTCCAGAGGTGACCTG

TATCCCAACAGCAACCTCACTAGTAAGCCACCCTGCCACCAAACGACAATCTTGGCACCAGACCCCAGACTTCACACCAACCAAATACAAAGAAAGAGCC

CCAGAGCAGCTGCGAGTCCTAGAGAACAGCTTTGCACAAAACCCACTTCCCCCCGAGGAGGAGCTGGACCGCCTAAGAAGTGAAACGAAAATGACTCGAA

GGGAAATTGATGGCTGGTTCTCAGAGAGGCGGAAAAAGGTGAATACTGAGGAGACAAAGAAAGCTGATGGGCACATGCCTAAGGAGGAGGAGGAGGGTGC

TGAGCAGGAGGGTAGAGATGAAGAGTTGGCCAATGAGCTGAGGGTCCCTGGTGAAAATGGCTCTCCTGAAATGTTTCTTAGCCATGCCTTGGCAGAACGG

AAGGTCAGCCCCATCAAAATCAACCTCAAGAACCTGCGGGTCACTGAAGCCAGTGGCAAGAGTGAGTTTCCAGGGATGGGTGTCTGTGAGCCTGAGGAAG

ATGGTTTGAACAAGTTGGTAGAACAGCCACCAAGCAAAGTAAGCTACAAAAAGACCGCACAGCAGCGTCATTTGCTTCGGCAGCTCTTTGTCCAAACACA

GTGGCCAAGCAACCAGGACTATGACTCCATTATGGCCCAAACAGGGCTGCCCCGGCCAGAGGTGGTACGCTGGTTTGGAGATAGCAGGTATGCCCTTAAG

AATGGCCAGCTCAAGTGGTACGAAGACTATAAGAGGGGAAACTTCCCACCAGGTTTGCTGGTCATAGCCCCTGGCAACCGAGAGCTGCTGCAAGATTATT

ACATGACACACAAGATGTTGTGTGAGGAAGATCTGCAGACCCTCTGTGATAAGACCCAGATGAGTGCCCAGCAGGTCAAGCAGTGGTTTGCTGAGAAGAT

GGGTGAAGAGACCCGGGCTGTGGCAGATATAAGCAGTGAGGATCAGGGCCCTAGAAATGGAGAGCCTGTGGCAGTTCACAAGGTGCTGGGTGATGCCTAT

TCGGAGCTGTCTGAGAACAGCGAATCATGGGAGCCAAGTGCTCCTGAGGCCAGCTCAGAGCCTTTTGACACTTCAAGTCCCCAGTCTGGACGTCAACTCG

GTAAGGAGCTCATGGGATCTAAGCATGGCTTTTCTCTGAACCTGAGGGAGGGTACAGTCACAGAGTAGGTACAGGTGGCAGGTACAGCTACCTCTAGAGC

ATTCAGACCAACTGCAGAGGAGTGAATGCCAGGGACAACTGGCAATAAAAGCCATAGAAGTAAAAGCTCAGAATTG
Translation
 - UNI35435 -  - UNI35435 - MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEAPDASSEAAPNPSSTDGSALANGHRSTL

DGYVYCCKECEFRSQDVTHFIGHMNSEHTDFNKDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSVLAGESTTEG

TEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVKEGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQ

QPPVHAQHHTHQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQGISWSPEEIEDARKKMF

NTVIQSVPQPTITVLNTPLVASAGNVQHLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVCSNSASAVKVVNAAQ

SLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFP

LASKVPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEEELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADG

HMPKEEEEGAEQEGRDEELANELRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNKLVEQPPSKVSYKKTAQQRH

LLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSAQ

QVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLGKELMGSKHGFSLNLREGTVTE

For any suggestions or comments, please send an email to unitrap@crg.es