Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000035919 (Bbs9)
Chromosomal location
Chr 9: 22280189 - 22692718 (+)
Description
Bardet-Biedl syndrome 9 (human) Gene [Source:MGI Symbol;Acc:MGI:2442833]
RefSeq_dna
NM_181316 
RefSeq_peptide
NP_848502.1 NP_851833.2 
UniGene
Mm.176725 
MGI
MGI:2442833 
Uniprot/SWISSPROT
Q811G0 
Human Ortholog
ENSG00000122507 (BBS9)
Omim 209900 - BARDET-BIEDL SYNDROME  601583 - WILMS TUMOR 5  
UniTrap UNI17230
Vector Insertion
Chr 9: 22280500 - 22295261
Public Clones (sanger)
Private Clones OST447220 (lexicon) OST176188 (lexicon) OST130090 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26648
Vector Insertion
Chr 9: 22301304 - 22308488
Public Clones not available
Private Clones OST105862 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17777
Vector Insertion
Chr 9: 22308554 - 22318423
Public Clones not available
Private Clones OST436622 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33550
Vector Insertion
Chr 9: 22452479 - 22459668
Public Clones IST11516D7 (tigm) IST12934E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5807
Vector Insertion
Chr 9: 22459810 - 22463493
Public Clones CSH755 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7884
Vector Insertion
Chr 9: 22483509 - 22598194
Public Clones RRJ692 (baygenomics) IST12243D1 (tigm) IST11751G3 (tigm) IST13845B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35988
Vector Insertion
Chr 9: 22616988 - 22692024
Public Clones IST13084H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039798
Sequence
GAAGGCGGTTTGGATTCAGGCTGGAGTGGGGAGGTGTCTTCCGCAGGCTGTTGTCTTGCAGCCTCACCCCTCTTACAGTCTCCCTGGTGGTTTCATCCTC

TCTGTGAGCATCCGGACTTGGAGTTTTTCTCTCTTGTCACTTGTGGCTTCCGAGGGATCCATGTCGTCTCCCCTGCTTGTCTCTGGGGGATGACAAGAGG

GTGCAGGGGATCTTGGGACTCACTTCACCTCCGCGGAGCTTGTGTTGCTGCTTGGCAGGATTCTGTCTGCTTGGGAACGTGGAAAACTTCGAACACAAAC

AAGACCAAGAG - UNI17230 - GTTGAAAGGAAATGTCCTTATTTAAAGCCCGTGACTGGTGGTCTACTGTGTTGGGAGAAAAAGAAGAATTTGACC

AGGGCTGCTTATGCTTGGCTGATGTGGACAACAGTGGGAACGGCCACG ATAAAATCATTGTGGGCAGCTTCATGGGCTACCTGAGAATCTTTAGTCCCC

ATTCTGTAAAAGCTGGAGGTGGGCCTCAGGCTGAAGATTTACTTCTAGAAGTGCATCTGCGGGACCCAGTGCTGCAAGTGGAAGTCGGGAAGTTTGTCTC

 - UNI26648 - GGGCACCGAGATGCTTCATCTGGCCGTGCTGCACTCCCGGAAGCTCTGTGTCTACTCCGTCTCAG - UNI17777 - GGACATT

GGGAAATGTGGAACATGGAAACCAATATCAGATAAAACTAATGTATGAGCACCATCTTCAGAGGACGGCCTGCAATATGACGTATGGACCCTTTGGTGGT

GTAAAAG GTCGGGATTTAATTTGTATCCAGTCTCTGGATGGGATGCTGATGGTGTTTGAGCAGGAAAGCTATGCGTTTGGGAGGTTTCTCCCTGGTTTT

CTTCTGCCTGGCCCTCTTGCTTACAGTCCCCGCACGGATTCCTTCATAACTGTGTCTTCTTGCAGACAAGTGGAAAGTTACAA GTACCAGGTACTTGCC

TTTGCCACAGATGCAGACAAGAAGCAGGAGATGGAACAGCAAAAACTTGGTTCTGGAAAGCGGCTAGTT GTGGACTGGACTCTGAATATTGGCGAGCAA

GCCCTTGATATCTGTATCTTCCCTTTGAACCAATCTGCATCTTCTGTTTTTGTTCTTGGTGAGAGAAACTTCTTTTGCCTAAAGGATAATGGGCAGATTC

GATTCATGAAGAAGCTCGGTTATAACCCCAGTTGTTTTCTACCGTACTGCTCAG TTTCTGAAGGTACAATAAATACTTTGATTGGAAACCATAACCACA

TGCTGCATATTTACCAGGACGTGACACTGAAGTGGGCCACACAACTCCCCCACGTCCCCGTGGCCGTCAGAGTAGGCTGTTTTCA TGATTTGAAGGGAG

TGATAGTGACTCTCAGTGATGACGGTCACCTGCAGTGCTCGTATCTGGGGACAGACCCTTCTTTGTTCCAGGCTCCAAAAGTTGAATCAAGAGAGCTCAA

CTATGATGAACTTGATGTGGAATTGAAAGAACTTCAGAAAATCATCAAAGATGTAAAGTTGCAAG GTGTTTGGCCCTTGACTGAACAGGAAGATGACTT

GAAAGTCTCTGCTTCAGTGTCTTCTACCCTGGATTCTGTGTCT CAAGCCACCAATGTGGAACCTGGAGCTGACTCTGTCCCGTCCATCACAGTGAAG A

TTACCCTGCAGAACCGAGTGGTGTTGCAGAAGGTCAAGCTGTCTATCTATGTGCAGCCTCCACTACAGTTGACTTGTGATCAGTTCACCTTTGACTTCAC

GG TTCCAGATATGACGAGTTCAGTAGCGTTTTCTGTGTACCTGAAGAGAAACTACACACCATCCGAGTTAGAAGGAAATGCTGTTGTTTCTTACTCCAG

ACCGACAG - UNI33550 - GTATTCCTCGGGTTGTCCAATGTAAATTTAGACTTCCTCTGAAACTGATTTGCCTACCTGGTCAGCCTTCAAAAACTG

CAAGCCACAAACTAACTATAGACACCAACAAATCTCCTGTCAGTCTGCTCGGTCTCTTCCCAG - UNI5807 - ACTTTGCCAACCCATCAGATGACG

ACCAAGTGAATGTAATGGGCTTCCGTCTCCTAGGAGGCGCTCGAGTGACTCTTCTTGCTTCCAGAACATCCC AACGATACCGCATTCAGAGCGAACAGT

TTGAAGATCTCTGGCTCATAACCAATGAACTCATCCTCCGCCTTCAGGAACATTTTGAAAAACAGGGAACCAAAGACTTTTCGTGTTCTTTTTCTGGGTG

TGTGCCCCTTCAAGAATATTTTGAGTTGATTGATCATCATTTTGAG CTGCGGATAAATGGTAAAAAATTGGAAGAACTTTTATCTGAAAGAGCTGTACA

ATTTCGGGCCATTCAGCGTCGGCTTCTGACAAGATTCAGAGACAAGACCCCTGCCCCACTGCAGCACCTGGACACCCTGCTGGACGGGACATACAAGCAG

 - UNI7884 - GTGATTGCTCTAGCAGATGCGATCGAGGAGAACCAGGACAGGCTGTTGCAGTCATTCTCAGGCCTGAAGAGTGCCACCCATTTGCTG

ATCCTGCTAATCAGGCTGTGGCAGAGGCTGAGCGCTGACCAGACTGCTATTCTGGAAGCAGCATTTCTGCCACTACAGGAAGACACGCAGGAACTG GGC

TGGGAAGAAACCGTGGATGCTGCCATTGCCTACCTTTTGAAAACCTGCCTGTCGAAGAGTTCCAAGGAGCAGGCTTTGAACCTCAGCAGCCAACTGAACA

TACCCAAAGATACCAGCCGGCTGAAGAAGCACATCACCCTGCTGTGTGATAGGTTAGCCAAAGGTGGGCGTCTCTGCGTGAGCACAGATGCAGCGGCCCC

GCAGGCCATGGTTGTGCCAG - UNI35988 - GTGGCTGTACTCCAATCCCAGAGTCAGACCTAGAGGAAAGGTCACTAGATGACTCCACAGAGCTGT

TTACCAACCACAAGCACCTCATGACCGAGCCCCCCATGCCTG AAGTCTCAGCCCGCCAAGGAGTTTTGGAATAGTCTGGAGTAATGCTAATGAGTTGAG

GGGAGAGGCCATTACAGAGGCTACCCTGTCTGGACACTGTGTTCCCATCCCGGTGCTGTGCCAAGCTCATCTCTGGAGGTGACTGCATGAAGATGGGGTC

AGGGCTGTTGGTTGCTAGGAGGGCGTGGGATGTCACAGACAGGTCAGCTGAAAGACAAGATTTGTCTTTTCTTCCCAAGAAAATGGTTGCTGCCTTTAGT

CACATGCGCTTATAGTCAGGATTTAGCAAGGTGACGAAGTTTGGGGACAGACTTTATAATACAGGGATCCAGATGTAAAATAATTTCATAGCCCATTTTT

TTCCACAGGATTCTTATGTAGTAACTGTTTCAAGTTTAATAAAGCATCGTATTGTC
Translation
 - UNI17230 - MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHD DKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVG

KFVS - UNI26648 - SGTEMLHLAVLHSRKLCVYSVSG - UNI17777 - GTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKG GRDLI

CIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYK KYQVLAFATDADKKQEMEQQKLGSGKRLV VDWTLNIGEQALDIC

IFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSV VSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFH HDLKGVI

VTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQG GVWPLTEQEDDLKVSASVSSTLDSVS QATNVEPGADSVPSITVK

 ITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTV VPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTG - UNI33550 - GIPRVVQCKFRLP

LKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPD - UNI5807 - DFANPSDDDQVNVMGFRLLGGARVTLLASRTSQ QRYRIQSEQFEDLWLITN

ELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFE LRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQ - UNI78

84 - VIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQEL GWEETVDAAIAYLLKTCLSKSSKEQALNLSSQL

NIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPG - UNI35988 - GGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPE EVSARQ

GVLE
Transcript ENSMUST00000115296
Sequence
GAAGGCGGTTTGGATTCAGGCTGGAGTGGGGAGGTGTCTTCCGCAGGCTGTTGTCTTGCAGCCTCACCCCTCTTACAGTCTCCCTGGTGGTTTCATCCTC

TCTGTGAGCATCCGGACTTGGAGTTTTTCTCTCTTGTCACTTGTGGCTTCCGAGGGATCCATGTCGTCTCCCCTGCTTGTCTCTGGGGGATGACAAGAGG

GTGCAGGGGATCTTGGGACTCACTTCACCTCCGCGGAGCTTGTGTTGCTGCTTGGCAGGATTCTGTCTGCTTGGGAACGTGGAAAACTTCGAACACAAAC

AAGACCAAGAG - UNI17230 - GTTGAAAGGAAATGTCCTTATTTAAAGCCCGTGACTGGTGGTCTACTGTGTTGGGAGAAAAAGAAGAATTTGACC

AGGGCTGCTTATGCTTGGCTGATGTGGACAACAGTGGGAACGGCCACG ATAAAATCATTGTGGGCAGCTTCATGGGCTACCTGAGAATCTTTAGTCCCC

ATTCTGTAAAAGCTGGAGGTGGGCCTCAGGCTGAAGATTTACTTCTAGAAGTGCATCTGCGGGACCCAGTGCTGCAAGTGGAAGTCGGGAAGTTTGTCTC

 - UNI26648 - GGGCACCGAGATGCTTCATCTGGCCGTGCTGCACTCCCGGAAGCTCTGTGTCTACTCCGTCTCAG - UNI17777 - GGACATT

GGGAAATGTGGAACATGGAAACCAATATCAGATAAAACTAATGTATGAGCACCATCTTCAGAGGACGGCCTGCAATATGACGTATGGACCCTTTGGTGGT

GTAAAAG GTCGGGATTTAATTTGTATCCAGTCTCTGGATGGGATGCTGATGGTGTTTGAGCAGGAAAGCTATGCGTTTGGGAGGTTTCTCCCTGGTTTT

CTTCTGCCTGGCCCTCTTGCTTACAGTCCCCGCACGGATTCCTTCATAACTGTGTCTTCTTGCAGACAAGTGGAAAGTTACAA GTACCAGGTACTTGCC

TTTGCCACAGATGCAGACAAGAAGCAGGAGATGGAACAGCAAAAACTTGGTTCTGGAAAGCGGCTAGTT GTGGACTGGACTCTGAATATTGGCGAGCAA

GCCCTTGATATCTGTATCTTCCCTTTGAACCAATCTGCATCTTCTGTTTTTGTTCTTGGTGAGAGAAACTTCTTTTGCCTAAAGGATAATGGGCAGATTC

GATTCATGAAGAAGCTCGGTTATAACCCCAGTTGTTTTCTACCGTACTGCTCAG TTTCTGAAGGTACAATAAATACTTTGATTGGAAACCATAACCACA

TGCTGCATATTTACCAGGACGTGACACTGAAGTGGGCCACACAACTCCCCCACGTCCCCGTGGCCGTCAGAGTAGGCTGTTTTCA TGATTTGAAGGGAG

TGATAGTGACTCTCAGTGATGACGGTCACCTGCAGTGCTCGTATCTGGGGACAGACCCTTCTTTGTTCCAGGCTCCAAAAGTTGAATCAAGAGAGCTCAA

CTATGATGAACTTGATGTGGAATTGAAAGAACTTCAGAAAATCATCAAAGATGTAAAGTTGCAAG GTGTTTGGCCCTTGACTGAACAGGAAGATGACTT

GAAAGTCTCTGCTTCAGTGTCTTCTACCCTGGATTCTGTGTCT CAAGCCACCAATGTGGAACCTGGAGCTGACTCTGTCCCGTCCATCACAGTGAAG A

TTACCCTGCAGAACCGAGTGGTGTTGCAGAAGGTCAAGCTGTCTATCTATGTGCAGCCTCCACTACAGTTGACTTGTGATCAGTTCACCTTTGACTTCAC

GG TTCCAGATATGACGAGTTCAGTAGCGTTTTCTGTGTACCTGAAGAGAAACTACACACCATCCGAGTTAGAAGGAAATGCTGTTGTTTCTTACTCCAG

ACCGACAG ATCGAAATCCTGATG - UNI33550 - GTATTCCTCGGGTTGTCCAATGTAAATTTAGACTTCCTCTGAAACTGATTTGCCTACCTGGT

CAGCCTTCAAAAACTGCAAGCCACAAACTAACTATAGACACCAACAAATCTCCTGTCAGTCTGCTCGGTCTCTTCCCAG - UNI5807 - ACTTTGCC

AACCCATCAGATGACGACCAAGTGAATGTAATGGGCTTCCGTCTCCTAGGAGGCGCTCGAGTGACTCTTCTTGCTTCCAGAACATCCC AACGATACCGC

ATTCAGAGCGAACAGTTTGAAGATCTCTGGCTCATAACCAATGAACTCATCCTCCGCCTTCAGGAACATTTTGAAAAACAGGGAACCAAAGACTTTTCGT

GTTCTTTTTCTGGGTGTGTGCCCCTTCAAGAATATTTTGAGTTGATTGATCATCATTTTGAG CTGCGGATAAATGGTAAAAAATTGGAAGAACTTTTAT

CTGAAAGAGCTGTACAATTTCGGGCCATTCAGCGTCGGCTTCTGACAAGATTCAGAGACAAGACCCCTGCCCCACTGCAGCACCTGGACACCCTGCTGGA

CGGGACATACAAGCAG - UNI7884 - GTGATTGCTCTAGCAGATGCGATCGAGGAGAACCAGGACAGGCTGTTGCAGTCATTCTCAGGCCTGAAGAG

TGCCACCCATTTGCTGATCCTGCTAATCAGGCTGTGGCAGAGGCTGAGCGCTGACCAGACTGCTATTCTGGAAGCAGCATTTCTGCCACTACAGGAAGAC

ACGCAGGAACTG GGCTGGGAAGAAACCGTGGATGCTGCCATTGCCTACCTTTTGAAAACCTGCCTGTCGAAGAGTTCCAAGGAGCAGGCTTTGAACCTC

AGCAGCCAACTGAACATACCCAAAGATACCAGCCGGCTGAAGAAGCACATCACCCTGCTGTGTGATAGGTTAGCCAAAGGTGGGCGTCTCTGCGTGAGCA

CAGATGCAGCGGCCCCGCAGGCCATGGTTGTGCCAG - UNI35988 - GTGGCTGTACTCCAATCCCAGAGTCAGACCTAGAGGAAAGGTCACTAGAT

GACTCCACAGAGCTGTTTACCAACCACAAGCACCTCATGACCGAGCCCCCCATGCCTG AAGTCTCAGCCCGCCAAGGAGTTTTGGAATAGTCTGGAGTA

ATGCTAATGAGTTGAGGGGAGAGGCCATTACAGAGGCTACCCTGTCTGGACACTGTGTTCCCATCCCGGTGCTGTGCCAAGCTCATCTCTGGAGGTGACT

GCATGAAGATGGGGTCAGGGCTGTTGGTTGCTAGGAGGGCGTGGGATGTCACAGACAGGTCAGCTGAAAGACAAGATTTGTCTTTTCTTCCCAAGAAAAT

GGTTGCTGCCTTTAGTCACATGCGCTTATAGTCAGGATTTAGCAAGGTGACGAAGTTTGGGGACAGACTTTATAATACAGGGATCCAGATGTAAAATAAT

TTCATAGCCCATTTTTTTCCACAGGATTCTTATGTAGTAACTGTTTCAAGTTTAATAAAGCATCGTATTGTC
Translation
 - UNI17230 - MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHD DKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVG

KFVS - UNI26648 - SGTEMLHLAVLHSRKLCVYSVSG - UNI17777 - GTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKG GRDLI

CIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYK KYQVLAFATDADKKQEMEQQKLGSGKRLV VDWTLNIGEQALDIC

IFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSV VSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFH HDLKGVI

VTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQG GVWPLTEQEDDLKVSASVSSTLDSVS QATNVEPGADSVPSITVK

 ITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTV VPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTD DRNPDG - UNI33550 - GIPRVV

QCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPD - UNI5807 - DFANPSDDDQVNVMGFRLLGGARVTLLASRTSQ QRYRIQSEQFE

DLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFE LRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQ 

- UNI7884 - VIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQEL GWEETVDAAIAYLLKTCLSKSSKEQA

LNLSSQLNIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPG - UNI35988 - GGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPE

 EVSARQGVLE

For any suggestions or comments, please send an email to unitrap@crg.es