Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036009 (BC067068)
Chromosomal location
Chr 10: 105200310 - 105278427 (-)
Description
Uncharacterized protein C12orf26 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q6NXH8]
RefSeq_dna
NM_207522 
RefSeq_peptide
NP_997405.1 
UniGene
Mm.404069 
MGI
MGI:3041259 
Uniprot/SWISSPROT
Q6NXH8 
Human Ortholog
ENSG00000127720 (C12orf26)
Omim not available
UniTrap UNI9843
Vector Insertion
Chr 10: 105270072 - 105278131
Public Clones XB323 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2837
Vector Insertion
Chr 10: 105260367 - 105263053
Public Clones AG0310 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046638
Sequence
GGGGAAGAGAGGGGTCGCGCGGCCATGTTGGCGCCACCTGCAGCCCCGGAGGATGAGCGTCATGGCGGCGGCCTGCCCTCTGCCCAGGACCCCGGACCTG

CCCACGCTGCACGACAAGTTACAGGGCTTGCTGAGCTTCCTCAGGGGCGCCCTGGCCATTTCCAGCGCGCACACGGTGGACTTCTACACCAAGTCGGTCT

GGCAGGAGCTGGTCGACCTGCCCCCTGAGAGCGTGCTGGCGGCGCTGAGGGAGTCGGCGGTGGAGGCCGAGCCGCGCGAGGCAGAGACGGGATCAG - U

NI9843 - GTTTCACTGAGCTCCCCAAAATATTTTGTGAAACTTCTCAGAAGCTGTTGAGTGTGGAAGCTTTTGCCCGAACTGCAAAGCACTATTCTGT

GCAAAACTTGGGACTGTGCACTCCTTCTGAGCAGTTGCTCACAGCCCTCCAAGGAAATAAAAGGCAGAGAGTTG ATGAAAATGTGAAGGCAATTGAGTT

TATGAATACAAAAAAATCTCATGAGGTTCAGGCAATGTCAGAGCTAATCTGCAGTATTGCTGATTACTGTGGCTTAAAGCAG ATAATTGACGTGGGTTC

TGGTAAAGGCTATCTAAGCTCCTTTTTGTCCTTAAAATATGGTTTGAACGTTTATGGCATCGATTCCTCAAACACTAACACTCACGGCGCGAAGGAGAGA

AACAGGAAGTTGAAGAAGCATTGGAGCCTGTATCACCCTCACTCAAGAGCAGACGCCAACGGCTGGGCATCAGAAAGGCCCAGAGAGTTGAAAGTGCCAA

AGGGAGTGGAGTGTAAGGGGGACGCTGAGAGCGTGCAGAGGAGCAGGCTTGGGAATCCAGACCTGTCTGCCACCGATGGTTTGCCTGATTTCTCAGGCTC

TGCAATTTCAGTCATCAGAAAACAGCAAAAAAACGTGCTTGCTCAGCCAGCTGAGGAAGAAAATTTGTATTTTGAAGATGCCTTTTCTCTCATAGACTTT

TTACCTGTTGATGCCATCGAACCTACTTCATCACAGGTGCAGAACACAGAAAAGTCTGGACTGAGAAAAGAGAGAAGAAATACGGCATCCAAGGCAAGGG

ACTCAAGCATATATTCACCACTAACCTCTTTCATCACTGCTGATTCACAATTGCATGACATTATTGAAGATCTGGAG - UNI2837 - GACTGTTTAA

TGGTGGGACTGCATACCTGTGGTGACCTTGCACCCAGTACTCTGCGGATATTTACATCCAAGGCTGAAGTCAAGGCAGTTTGCAGTGTGGGTTGTTGCTA

CCATCTCCTATCTGAGGAGTTTGAAAACCAGCATAAAGATA GATGTGCTAACGAAAACTGGGGGTTTCCAATGTGCCACTATCTGAAAGAGGAGAGATG

GTGCTGCGGCCGTAATGCAAGAATGTCAGCATGTTTG GCATTGCAGCGGGTTGCAGTTGGCCAAGGG CTGCCTACTGAATCACTCTTCTATCGTGCTG

TTCTTCAGAATATTATTAAGGATTATTATGGCATCAGCAAATG TGAACAGCACGTTGGTAAAATTTATTCCAAATGTTCCTCTTTTCTGGAGTATGTCA

GAATGTCTCTAAAGAAGCTTGGATTAGATGAGTCCAAG GTCTCTGAAGAAATTATAATGGACTACTATGAGAATTATAAGCCTAGAATGAATGAGCTAG

AGGCATTTAATATG TTGAAAGTTGTTCTGGCTCCTTGCATAGAAACACTGATTCTTCTTGATCGACTTTGTTACCTGAAGGAACAG GACGGTGTAGCC

TGGTCTGCCCTCGTGAAGTTGTTTGACCCTGTGCAGTCGCCCAGATGCTACGCTGTCATTGCTCTGAAGAAGCAGTGTGATCGTGGCTGAAGCAGAGTGC

TAGACAGCCTGGCTGGGGACTTACTGCTTTCTTAAACATTTATATCCTGTTATGTAAACATTTTAAATCTATATTTTAAATAATAAAATATTGCCT
Translation
MAAACPLPRTPDLPTLHDKLQGLLSFLRGALAISSAHTVDFYTKSVWQELVDLPPESVLAALRESAVEAEPREAETGSG - UNI9843 - GFTELPKI

FCETSQKLLSVEAFARTAKHYSVQNLGLCTPSEQLLTALQGNKRQRVD DENVKAIEFMNTKKSHEVQAMSELICSIADYCGLKQ IIDVGSGKGYLSSF

LSLKYGLNVYGIDSSNTNTHGAKERNRKLKKHWSLYHPHSRADANGWASERPRELKVPKGVECKGDAESVQRSRLGNPDLSATDGLPDFSGSAISVIRKQ

QKNVLAQPAEEENLYFEDAFSLIDFLPVDAIEPTSSQVQNTEKSGLRKERRNTASKARDSSIYSPLTSFITADSQLHDIIEDLE - UNI2837 - DCL

MVGLHTCGDLAPSTLRIFTSKAEVKAVCSVGCCYHLLSEEFENQHKDR RCANENWGFPMCHYLKEERWCCGRNARMSACL ALQRVAVGQG LPTESLF

YRAVLQNIIKDYYGISKC CEQHVGKIYSKCSSFLEYVRMSLKKLGLDESK VSEEIIMDYYENYKPRMNELEAFNM LKVVLAPCIETLILLDRLCYLK

EQ DGVAWSALVKLFDPVQSPRCYAVIALKKQCDRG

For any suggestions or comments, please send an email to unitrap@crg.es