Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000036022 (4632404H22Rik)
Chromosomal location
Chr X: 50596602 - 50622975 (-)
Description
family with sequence similarity 122, member B Gene [Source:MGI Symbol;Acc:MGI:1926005]
RefSeq_dna
NM_030167 
RefSeq_peptide
NP_084443.1 
UniGene
Mm.28559 
MGI
MGI:1926005 
Uniprot/SWISSPROT
Q6NZE7 
Uniprot/SPTREMBL
B1B0Y5 B1B0Y4 
Human Ortholog
ENSG00000156504 (FAM122B)
Omim not available
UniTrap UNI1853
Vector Insertion
Chr X: 50613911 - 50619217
Public Clones AZ0548 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18408
Vector Insertion
Chr X: 50613104 - 50613371
Public Clones not available
Private Clones OST423945 (lexicon) OST177588 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114838
Sequence
CCAGGAGCCGAGAGCACTGCCGGCTGTGTTGCCTAGCAAGTATCCGAATGGCTCAGGAGAAAATGGATCTGGATTTTGAGGCTGACACATCTGAGGGGGC

CACCCTGAGACGGTCCAACAGTGCTCCCCTGATCCATGTGCTCAG TGACCTTTCACAGGTTTTTGAGCCATATCCACTTAGAACTGGGAGGACCAGTAC

GGCAATTATGAGCCATCATAGCTTG - UNI1853 - GAAGAAGGCCTGGATATGATGAACAGAGAAACTACAAATGAAAG GGAAGCACAAGCAGGGA

TGCAGATAAGCCAGTCATGGGACGAAAGCCTGAGCCTG AGTGATAGTGATTTTGACAAGCCAGAGAAATTATATTCTCCCAAAAGAATTGACTTCACTC

CAGTTTCTCCAGCTCCTTCCCCAACCAGAGGATTTGGAAAG - UNI18408 - CAATGCTTGTCGCCATCCTTGCAAATGTTTGTGAGCAGCAGCGGG

ATGCCACCGAGTCCTGTTCTCAATCCAAGACATTTTTCAAG GAGGAGCCAGAGCCCGGTCAAGTGCATTAGGCCCAGTGTTCTTGGTCCTCTTAAGAGA

AAAG GGGAAATGGAGATGGAAAGCCAGCCTAAGAGACCCTTCCAAGGCACCACCAGCATGCTGTCTACCAATCCTGCACAATTGTCTGATTTCAGTTCA

TG TTCAGATATTTTGGATGGCAGTAGTATCAGCAGTGGCTTGTCCTCAGACTCACTGGCTACAGGCAGCGCTCCCGCAGAGTCTCCAGTAGCATGCTCC

AATTCATGCTCTCCGTTCATCTTGATGGATGATCTCTCACCCAAGTGACTTAACCATTTCTGATTGAGTGTTTTAACTGTTTCCCACATAAAACATTCAG

TGAGGAATGCGGAGAACTTTGATCCACAATGGGGATTAAAGTTTGGCAGATTGCAACCATTCCGATGATGCTCCTATTTCTGGGCATCTCTCTCTAAAGT

TCAATTTTGCAAGCAGAGTCACCTTACTAACATCTGTTTGGGCTGATCTCATTTTGCGTTTGATGACTAAATCTCAAATACACATTTCTGATTGCTTGGA

GGACTTTTTCCCTAGTGCCTCAAAGAGCACCTACTTTCAAACATTTAAGGGGAGCATTCATGCATATTCTCTATAATTGTTCTTTTCCCTAGCAGTGGCA

AAACAGAGTTAATCAGAAATTCTCTTGCTTGAGAGATTTATAAAAATTCTCTGTTGACTACATACTTTCCCATCTCTTTATTTCATGGTAATATTCAAAT

TGTTTTTGATTATATCAAATTTTCATTTTGTCTGCATCAGCTTTAAAGAACATTGTTTTGTTTCCCTTGCCTGTTTGACCTGCTCCTTGCCATTTCTCAC

CAAGGGGAAGAAACCCATAGTTGCTTCCATCACCACCATTCTTGCTTCTTTGCTATTGGAATGTATGCAGTAACGTCTGATTTTACAATGTAGAATGAAC

TAGACTTACAGGATGCCTGCATTAGTCACCTCAGGGTCTTAGGACTTTGCTATCACAGTTGCTATTTTTCTCCCCAAACCTGGTGCCTTAAGGGATATAT

AAAATATTGTTGATATTTCTAGGTGGTGTTATCAAGGAGAAGAAATTCCTGCCTTGACCAGATGTGTGGAGCATCTACAAATGAACGAATAGTTATTTAC

ACAAACCACTGTACAAAAGCAAGCAAGCGTCCATGAAGCTGTCAGTGTCTTGGGTAGTATTATGAGGCCTTAGGTGCCTTGGGGTACATTGCCGTCCTGT

AGGGAATATGTGTCGTAGGGTCTTGTGGAAATGGAAGCTTTCTGTATGTGCGTGCTATTCTGTTTGATTTTTTTTTCCTGATTCCCTGTTGTCCTTGAGT

TTGTTCTGTCATGTGGTGACCGGGTGTTGTTGGTTTTTGTGCTGTGCTAGAGTCAGAACCCTCTTCTTGTCCTTGTTGCCCTATAGAGGTCAGTTTAATA

TCTTAATATCAGTTAAGGAAGCTTTGAGGAGCTAAAAAGGTCAGTACTGCTGTGCCCTCTGCTTCCAGAAGTGTTTTGAGCTCTAAGCAGTGTATATGCA

GTGTGACGTAACATATACTCTGTAATTTTTACAAAAGAAAACTCCTGACTAAAATATTTAAGAAATCCACGTGTGATCTATTGTGGCAGTATTTATTATG

TATTACACTAGAAATGGTGTAATAGTGCGATGTCTGTGCGGTTAGGTTTCTTTTAATGTTCAACCTGGTGGATGGACTATTTGTTTAATATTCCCACTAG

AATCGTGTTATTAAGTGAATGTAAAAAAAAAAACAAACAGAAAATGATTAAGCATAAGTCTTTTGAAATCTAAAGTCCTTGGAGGTGGTTTGAAGGTATT

TACAGACTAGAAATTAGTGAGCTTGAAGCAAAACCTCTCTTCTAATTATCAGAGACCATCACTTAGCTTGCTGCAGTTCCATTATAGAATCAGGTCTTAA

GTTTACATTGTAATCACTGTCATAAAAGCTATTACTGGCCTGAGTTCCCATGTTTCTTTAGCCTGTGAAAAGCTCCTAATCCTCCAAACCTAACATAAAT

GTGCTGTTAGAAGACTCGCCCACTCCTGTGCTATTTTAAAGAAACAATTCTTTGATAGCACTCGGTGTATCCACTCTGTTAATGAACCGTATTCAAAGGC

TCTTGCCTTCGTAATGATAAGAGATGAGTTTTTCTTTCAGGAGATTTGTCTGCCTTCACTCTTCTGTCTTATTTGCCTTAAAGGGACACTTTGCAGTTCA

AATTTAGAGTCCAGATTTAGGATTCTTAAAAAATAATCTTTGAAATGTGATGATACCTAAATTTGTGTTTAAAACTCAATGGTAAGGTAAAACCAGAGCA

GAAAACTGAAACTGTCCCAATGGTATGATGAGATCAAAGAGGCAGGATTCCCTTTACTGTTTGAGACCAACTCTTTTACTAATGTTTCTAATTGAGTGTT

TTCAATTTGTTCTTTCTCAATTCCATACTCATTTAAAATTCATTCTGATTACTCTTGCCCCCTACCCTCCTGCATCTCTGTCCCAACCATCAGTCACCAC

TTCTTCTTACAGATTCCCTTATCACATTCTTGTCTTTTTCGTTGTAAAGTAACCTTTTATTATTGTTGTCTTCTATATTGTTTAAATGGACTAGAAAGCT

AAGTTTGTGCAGGGATTGTTTTGAAATAAATAAAACTGGTAATATGCTAATCCACAGAGCAGCTTTGTTGACAGTACCCCTTTATTTTTATATAAAGTCT

AATATTTGAAATGTAGTTCTTGTTATAAAGTAAAATTCTTTCTTCCTATTCTCATATTATATCATATATTTTCAGCTTCTCTTTGAAAACTACTACAAAA

AAATGAAACCATAATAAAATCCTATAGATACTGGTTTTGCTTGACTGACTTATAAATCACTGTTTTATGATAACTGCTTTTGGAATAATAGAAAGTTTTG

TGAAATGTTGACCTAGTGTATACCCTAAAATTGTGAATTTAATAAAGTATATATACGTGTATAAAAAGA
Translation
MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLS SDLSQVFEPYPLRTGRTSTAIMSHHSL - UNI1853 - EEGLDMMNRETTNER REAQAGMQIS

QSWDESLSL SDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGK - UNI18408 - QCLSPSLQMFVSSSGMPPSPVLNPRHFSR RRSQSPVKCIRP

SVLGPLKRKG GEMEMESQPKRPFQGTTSMLSTNPAQLSDFSSC CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK
Transcript ENSMUST00000114837
Sequence
ATTTCTGAAGCGTGGGAGGCAAAAGAGGCGGCAGGTTATAGAAATCAATTTGAGCTCCAGAGGGTCCCGCGGGTCATTAGAGCCAATAAGAGATAGAAGC

AGCGCCGCGGTGGTGCAGAGGGCCGATCCCTTTTCTGAGTCGTGCAGGCGGGCAGGGACCAGGGAGTGAAAAGCGCCATCCCTGCGCTGAGGGGCCCCGG

GGACCGGGGCCCAGAGCATGGCGGACTGGACAGAGACCCTGAGCATGTGGAGGTGGGGCAGCCGAGGCCGCCTGGCCAGCTGTCAAGTCCTCATTGCTAG

CGCTGCAAAGGCAGCCTCTGTAAATGTAGCCGAGCCGCGCTTGCGGTCCTAGGCGGGAAAAATGACAGCTTGAGTTCTGCCACTGCCTAGTTTCCTCCCC

TTTCTTCTCCTGTGCTTCCACATTCTCCCTCCTCCTCTTTTCCCATCCCTGTGCCCCTTCACCCTGACCTTTTTCCTCCTTTCCCACTTCTATGCTCTTT

CATTAGTGCTATGCCCTGCATTTCCATCTATCCTTTATCAACCCCTGTGCCTCTTTTTCTTTCTCCCACCTTTGTCTTTCCTCCATCCCCTTTTTCATCC

TGTCACCCTCCCAACACCAGCTCTATATCCTCCTCCGCCCGCCCTCCACATCCTTCCTCATCTGCATCCTCCTCTCCTACTTTTCTCCGCCCTCGCTCCC

AAGCCTCCGCCCATTAGCCCCCGCCCCCAGCTGCCAGTCCCCAGCAGCTCAGTCCTGCAGTGAGTCCATAGCAAAGCACCAGGAGCCGAGAGCACTGCCG

GCTGTGTTGCCTAGCAAGTATCCGAATGGCTCAGGAGAAAATGGATCTGGATTTTGAGGCTGACACATCTGAGGGGGCCACCCTGAGACGGTCCAACAGT

GCTCCCCTGATCCATGTGCTCAG TGACCTTTCACAGGTTTTTGAGCCATATCCACTTAGAACTGGGAGGACCAGTACGGCAATTATGAGCCATCATAGC

TTG - UNI1853 - GAAGAAGGCCTGGATATGATGAACAGAGAAACTACAAATGAAAG GGAAGCACAAGCAGGGATGCAGATAAGCCAGTCATGGGA

CGAAAGCCTGAGCCTG AGTGATAGTGATTTTGACAAGCCAGAGAAATTATATTCTCCCAAAAGAATTGACTTCACTCCAGTTTCTCCAGCTCCTTCCCC

AACCAGAGGATTTGGAAAG - UNI18408 - CAATGCTTGTCGCCATCCTTGCAAATGTTTGTGAGCAGCAGCGGGATGCCACCGAGTCCTGTTCTCA

ATCCAAGACATTTTTCAAG GAGGAGCCAGAGCCCGGTCAAGTGCATTAGGCCCAGTGTTCTTGGTCCTCTTAAGAGAAAAG GGGAAATGGAGATGGAA

AGCCAGCCTAAGAGACCCTTCCAAGGCACCACCAGCATGCTGTCTACCAATCCTGCACAATTGTCTGATTTCAGTTCATGGT GGGGGAGTCTCCATGGA

GGTGTAAGTGATTTTGAATGA
Translation
MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLS SDLSQVFEPYPLRTGRTSTAIMSHHSL - UNI1853 - EEGLDMMNRETTNER REAQAGMQIS

QSWDESLSL SDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGK - UNI18408 - QCLSPSLQMFVSSSGMPPSPVLNPRHFSR RRSQSPVKCIRP

SVLGPLKRKG GEMEMESQPKRPFQGTTSMLSTNPAQLSDFSSWW WGSLHGGVSDFE
Transcript ENSMUST00000071023
Sequence
ATAGCAAAGCACCAGGAGCCGAGAGCACTGCCGGCTGTGTTGCCTAGCAAGTATCCGAATGGCTCAGGAGAAAATGGATCTGGATTTTGAGGCTGACACA

TCTGAGGGGGCCACCCTGAGACGGTCCAACAGTGCTCCCCTGATCCATGTGCTCAG TGACCTTTCACAGGTTTTTGAGCCATATCCACTTAGAACTGGG

AGGACCAGTACGGCAATTATGAGCCATCATAGCTTG - UNI1853 - GAAGAAGGCCTGGATATGATGAACAGAGAAACTACAAATGAAAG GGAAGC

ACAAGCAGGGATGCAGATAAGCCAGTCATGGGACGAAAGCCTGAGCCTG AGTGATAGTGATTTTGACAAGCCAGAGAAATTATATTCTCCCAAAAGAAT

TGACTTCACTCCAGTTTCTCCAGCTCCTTCCCCAACCAGAGGATTTGGAAAG - UNI18408 - CAATGCTTGTCGCCATCCTTGCAAATGTTTGTGA

GCAGCAGCGGGATGCCACCGAGTCCTGTTCTCAATCCAAGACATTTTTCAAG CAGGAGGAGCCAGAGCCCGGTCAAGTGCATTAGGCCCAGTGTTCTTG

GTCCTCTTAAGAGAAAAG GGGAAATGGAGATGGAAAGCCAGCCTAAGAGACCCTTCCAAGGCACCACCAGCATGCTGTCTACCAATCCTGCACAATTGT

CTGATTTCAGTTCATG TTCAGATATTTTGGATGGCAGTAGTATCAGCAGTGGCTTGTCCTCAGACTCACTGGCTACAGGCAGCGCTCCCGCAGAGTCTC

CAGTAGCATGCTCCAATTCATGCTCTCCGTTCATCTTGATGGATGATCTCTCACCCAAGTGACTTAACCATTTCTGATTGAGTGTTTTAACTGTTTCCCA

CATAAAACATTCAGTGAGGAATGCGGAGAACTTTGATCCACAATGGGGATTAAAGTTTGGCAGATTGCAACCATTCCGATGATGCTCCTATTTCTGGGCA

TCTCTCTCTAAAGTTCAATTTTGCAAGCAGAGTCACCTTACTAACATCTGTTTGGGCTGATCTCATTTTGCGTTTGATGACTAAATCTCAAATACACATT

TCTGATTGCTTGGAGGACTTTTTCCCTAGTGCCTCAAAGAGCACCTACTTTCAAACATTTAAGGGGAGCATTCATGCATATTCTCTATAATTGTTCTTTT

CCCTAGCAGTGGCAAAACAGAGTTAATCAGAAATTCTCTTGCTTGAGAGATTTATAAAAATTCTCTGTTGACTACATACTTTCCCATCTCTTTATTTCAT

GGTAATATTCAAATTGTTTTTGATTATATCAAATTTTCATTTTGTCTGCATCAGCTTTAAAGAACATTGTTTTGTTTCCCTTGCCTGTTTGACCTGCTCC

TTGCCATTTCTCACCAAGGGGAAGAAACCCATAGTTGCTTCCATCACCACCATTCTTGCTTCTTTGCTATTGGAATGTATGCAGTAACGTCTGATTTTAC

AATGTAGAATGAACTAGACTTACAGGATGCCTGCATTAGTCACCTCAGGGTCTTAGGACTTTGCTATCACAGTTGCTATTTTTCTCCCCAAACCTGGTGC

CTTAAGGGATATATAAAATATTGTTGATATTTCTAGGTGGTGTTATCAAGGAGAAGAAATTCCTGCCTTGACCAGATGTGTGGAGCATCTACAAATGAAC

GAATAGTTATTTACACAAACCACTGTACAAAAGCAAGCAAGCGTCCATGAAGCTGTCAGTGTCTTGGGTAGTATTATGAGGCCTTAGGTGCCTTGGGGTA

CATTGCCGTCCTGTAGGGAATATGTGTCGTAGGGTCTTGTGGAAATGGAAGCTTTCTGTATGTGCGTGCTATTCTGTTTGATTTTTTTTTCCTGATTCCC

TGTTGTCCTTGAGTTTGTTCTGTCATGTGGTGACCGGGTGTTGTTGGTTTTTGTGCTGTGCTAGAGTCAGAACCCTCTTCTTGTCCTTGTTGCCCTATAG

AGGTCAGTTTAATATCTTAATATCAGTTAAGGAAGCTTTGAGGAGCTAAAAAGGTCAGTACTGCTGTGCCCTCTGCTTCCAGAAGTGTTTTGAGCTCTAA

GCAGTGTATATGCAGTGTGACGTAACATATACTCTGTAATTTTTACAAAAGAAAACTCCTGACTAAAATATTTAAGAAATCCACGTGTGATCTATTGTGG

CAGTATTTATTATGTATTACACTAGAAATGGTGTAATAGTGCGATGTCTGTGCGGTTAGGTTTCTTTTAATGTTCAACCTGGTGGATGGACTATTTGTTT

AATATTCCCACTAGAATCGTGTTATTAAGTGAATGTAAAAAAAAAAACAAACAGAAAATGATTAAGCATAAGTCTTTTGAAATCTAAAGTCCTTGGAGGT

GGTTTGAAGGTATTTACAGACTAGAAATTAGTGAGCTTGAAGCAAAACCTCTCTTCTAATTATCAGAGACCATCACTTAGCTTGCTGCAGTTCCATTATA

GAATCAGGTCTTAAGTTTACATTGTAATCACTGTCATAAAAGCTATTACTGGCCTGAGTTCCCATGTTTCTTTAGCCTGTGAAAAGCTCCTAATCCTCCA

AACCTAACATAAATGTGCTGTTAGAAGACTCGCCCACTCCTGTGCTATTTTAAAGAAACAATTCTTTGATAGCACTCGGTGTATCCACTCTGTTAATGAA

CCGTATTCAAAGGCTCTTGCCTTCGTAATGATAAGAGATGAGTTTTTCTTTCAGGAGATTTGTCTGCCTTCACTCTTCTGTCTTATTTGCCTTAAAGGGA

CACTTTGCAGTTCAAATTTAGAGTCCAGATTTAGGATTCTTAAAAAATAATCTTTGAAATGTGATGATACCTAAATTTGTGTTTAAAACTCAATGGTAAG

GTAAAACCAGAGCAGAAAACTGAAACTGTCCCAATGGTATGATGAGATCAAAGAGGCAGGATTCCCTTTACTGTTTGAGACCAACTCTTTTACTAATGTT

TCTAATTGAGTGTTTTCAATTTGTTCTTTCTCAATTCCATACTCATTTAAAATTCATTCTGATTACTCTTGCCCCCTACCCTCCTGCATCTCTGTCCCAA

CCATCAGTCACCACTTCTTCTTACAGATTCCCTTATCACATTCTTGTCTTTTTCGTTGTAAAGTAACCTTTTATTATTGTTGTCTTCTATATTGTTTAAA

TGGACTAGAAAGCTAAGTTTGTGCAGGGATTGTTTTGAAATAAATAAAACTGGTAATATGCTAATCCACAGAGCAGCTTTGTTGACAGTACCCCTTTATT

TTTATATAAAGTCTAATATTTGAAATGTAGTTCTTGTTATAAAGTAAAATTCTTTCTTCCTATTCTCATATTATATCATATATTTTCAGCTTCTCTTTGA

AAACTACTACAAAAAAATGAAACCATAATAAAATCCTATAGATACTGGTTTTGCTTGACTGACTTATAAATCACTGTTTTATGATAACTGCTTTTGGAAT

AATAGAAAGTTTTGTGAAATGTTGACCTAGTGTATACCCTAAAATTGTGAATTTAATAAAGTATATATACGTGT
Translation
MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLS SDLSQVFEPYPLRTGRTSTAIMSHHSL - UNI1853 - EEGLDMMNRETTNER REAQAGMQIS

QSWDESLSL SDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGK - UNI18408 - QCLSPSLQMFVSSSGMPPSPVLNPRHFSS SRRSQSPVKCIR

PSVLGPLKRKG GEMEMESQPKRPFQGTTSMLSTNPAQLSDFSSC CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK
Transcript ENSMUST00000114841
Sequence
ATTTCTGAAGCGTGGGAGGCAAAAGAGGCGGCAGGTTATAGAAATCAATTTGAGCTCCAGAGGGTCCCGCGGGTCATTAGAGCCAATAAGAGATAGAAGC

AGCGCCGCGGTGGTGCAGAGGGCCGATCCCTTTTCTGAGTCGTGCAGGCGGGCAGGGACCAGGGAGTGAAAAGCGCCATCCCTGCGCTGAGGGGCCCCGG

GGACCGGGGCCCAGAGCATGGCGGACTGGACAGAGACCCTGAGCATGTGGAGGTGGGGCAGCCGAGGCCGCCTGGCCAGCTGTCAAGTCCTCATTGCTAG

CGCTGCAAAGGCAGCCTCTGTAAATGTAGCCGAGCCGCGCTTGCGGTCCTAGGCGGGAAAAATGACAGCTTGAGTTCTGCCACTGCCTAGTTTCCTCCCC

TTTCTTCTCCTGTGCTTCCACATTCTCCCTCCTCCTCTTTTCCCATCCCTGTGCCCCTTCACCCTGACCTTTTTCCTCCTTTCCCACTTCTATGCTCTTT

CATTAGTGCTATGCCCTGCATTTCCATCTATCCTTTATCAACCCCTGTGCCTCTTTTTCTTTCTCCCACCTTTGTCTTTCCTCCATCCCCTTTTTCATCC

TGTCACCCTCCCAACACCAGCTCTATATCCTCCTCCGCCCGCCCTCCACATCCTTCCTCATCTGCATCCTCCTCTCCTACTTTTCTCCGCCCTCGCTCCC

AAGCCTCCGCCCATTAGCCCCCGCCCCCAGCTGCCAGTCCCCAGCAGCTCAGTCCTGCAGTGAGTCCATAGCAAAGCACCAGGAGCCGAGAGCACTGCCG

GCTGTGTTGCCTAGCAAGTATCCGAATGGCTCAGGAGAAAATGGATCTGGATTTTGAGGCTGACACATCTGAGGGGGCCACCCTGAGACGGTCCAACAGT

GCTCCCCTGATCCATGTGCTCAG TGACCTTTCACAGGTTTTTGAGCCATATCCACTTAGAACTGGGAGGACCAGTACGGCAATTATGAGCCATCATAGC

TTG - UNI1853 - GAAGAAGGCCTGGATATGATGAACAGAGAAACTACAAATGAAAG GGAAGCACAAGCAGGGATGCAGATAAGCCAGTCATGGGA

CGAAAGCCTGAGCCTG AGTGATAGTGATTTTGACAAGCCAGAGAAATTATATTCTCCCAAAAGAATTGACTTCACTCCAGTTTCTCCAGCTCCTTCCCC

AACCAGAGGATTTGGAAAG - UNI18408 - CAATGCTTGTCGCCATCCTTGCAAATGTTTGTGAGCAGCAGCGGGATGCCACCGAGTCCTGTTCTCA

ATCCAAGACATTTTTCAAG GAGGAGCCAGAGCCCGGTCAAGTGCATTAGGCCCAGTGTTCTTGGTCCTCTTAAGAGAAAAG GGGAAATGGAGATGGAA

AGCCAGCCTAAGAGACCCTTCCAAGGCACCACCAGCATGCTGTCTACCAATCCTGCACAATTGTCTGATTTCAGTTCATG GTGGTGTTATCAAGGAGAA

GAAATTCCTGCCTTGACCAGATGTGTGGAGCATCTACAAATGAACGAATAGTTATTTACACAAACCACTGTACAAAAGCAAGCAAGCGTCCATGAAGCTG

TCAGTGTCTTGGGTAGTATTATGAGGCCTTAGGTGCCTTGGGGTACATTGCCGTCCTGTAGGGAATATGTGTCGTAGGGTCTTGTGGAAATGGAAGCTTT

CTGTATGTGCGTGCTATTCTGTTTGATTTTTTTTTCCTGATTCCCTGTTGTCCTTGAGTTTGTTCTGTCATGTGGTGACCGGGTGTTGTTGGTTTTTGTG

CTGTGCTAGAGTCAGAACCCTCTTCTTGTCCTTGTTGCCCTATAGAGGTCAGTTTAATATCTTAATATCAGTTAAGGAAGCTTTGAGGAGCTAAAAAGGT

CAGTACTGCTGTGCCCTCTGCTTCCAGAAGTGTTTTGAGCTCTAAGCAGTGTATATGCAGTGTGACGTAACATATACTCTGTAATTTTTACAAAAGAAAA

CTCCTGACTAAAATATTTAAGAAATCCACGTGTGATCTATTGTGGCAGTATTTATTATGTATTACACTAGAAATGGTGTAATAGTGCGATGTCTGTGCGG

TTAGGTTTCTTTTAATGTTCAACCTGGTGGATGGACTATTTGTTTAATATTCCCACTAGAATCGTGTTATTAAGTGAATGTAAAAAAAAAAACAAACAGA

AAATGATTAAGCATAAGTCTTTTGAAATCTAAAGTCCTTGGAGGTGGTTTGAAGGTATTTACAGACTAGAAATTAGTGAGCTTGAAGCAAAACCTCTCTT

CTAATTATCAGAGACCATCACTTAGCTTGCTGCAGTTCCATTATAGAATCAGGTCTTAAGTTTACATTGTAATCACTGTCATAAAAGCTATTACTGGCCT

GAGTTCCCATGTTTCTTTAGCCTGTGAAAAGCTCCTAATCCTCCAAACCTAACATAAATGTGCTGTTAGAAGACTCGCCCACTCCTGTGCTATTTTAAAG

AAACAATTCTTTGATAGCACTCGGTGTATCCACTCTGTTAATGAACCGTATTCAAAGGCTCTTGCCTTCGTAATGATAAGAGATGAGTTTTTCTTTCAGG

AGATTTGTCTGCCTTCACTCTTCTGTCTTATTTGCCTTAAAGGGACACTTTGCAGTTCAAATTTAGAGTCCAGATTTAGGATTCTTAAAAAATAATCTTT

GAAATGTGATGATACCTAAATTTGTGTTTAAAACTCAATGGTAAGGTAAAACCAGAGCAGAAAACTGAAACTGTCCCAATGGTATGATGAGATCAAAGAG

GCAGGATTCCCTTTACTGTTTGAGACCAACTCTTTTACTAATGTTTCTAATTGAGTGTTTTCAATTTGTTCTTTCTCAATTCCATACTCATTTAAAATTC

ATTCTGATTACTCTTGCCCCCTACCCTCCTGCATCTCTGTCCCAACCATCAGTCACCACTTCTTCTTACAGATTCCCTTATCACATTCTTGTCTTTTTCG

TTGTAAAGTAACCTTTTATTATTGTTGTCTTCTATATTGTTTAAATGGACTAGAAAGCTAAGTTTGTGCAGGGATTGTTTTGAAATAAATAAAACTGGTA

ATATGCT
Translation
MAQEKMDLDFEADTSEGATLRRSNSAPLIHVLS SDLSQVFEPYPLRTGRTSTAIMSHHSL - UNI1853 - EEGLDMMNRETTNER REAQAGMQIS

QSWDESLSL SDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGK - UNI18408 - QCLSPSLQMFVSSSGMPPSPVLNPRHFSR RRSQSPVKCIRP

SVLGPLKRKG GEMEMESQPKRPFQGTTSMLSTNPAQLSDFSSW WWCYQGEEIPALTRCVEHLQMNE

For any suggestions or comments, please send an email to unitrap@crg.es